PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_016648144.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Amygdaleae; Prunus
Family GeBP
Protein Properties Length: 404aa    MW: 45167.6 Da    PI: 9.5865
Description GeBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_016648144.1genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF573104.86.6e-33175266195
          DUF573   1 klfqrlwseeDeivlLqGlidfkaktgkspsddidafyefvkksisfkvsksqlveKirrLKkKfkkkvkkaksgkepsfskehdqkifelskki 95 
                     klfqr+ws++Dei++L G+id+ +k+g++p+ d+ af +f+kks++++v+k+ql +KirrLKkK++++v+k   gke +  k+h+qk+f+l kk+
  XP_016648144.1 175 KLFQRIWSNDDEITILEGMIDYSTKKGANPYYDMGAFRDFIKKSLKADVNKTQLQDKIRRLKKKYEMNVAK---GKEYNPIKPHEQKVFDLXKKV 266
                     579********************************************************************...9****************9997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF045043.3E-30177266IPR007592Protein of unknown function DUF573
Sequence ? help Back to Top
Protein Sequence    Length: 404 aa     Download sequence    Send to blast
MAPKRPSSLD EPPTASYLEE KVASSEEEVH KEKEEESRSI FESESKEPEP PKATPTHVAE  60
KKPPPKKLNS TTVNSKQQSS SSGSXSESES DSEXDKDMVV KPISSKPMED KLKTKKPISK  120
ASATTTPAAR AGWKRPSESD PKDSKRPKKK IPDPDQEPDY AGEETKKAGG DDSKKLFQRI  180
WSNDDEITIL EGMIDYSTKK GANPYYDMGA FRDFIKKSLK ADVNKTQLQD KIRRLKKKYE  240
MNVAKGKEYN PIKPHEQKVF DLXKKVXSSD ERSIGVSGLS EXSKSNGKAR TNQKGNNKTL  300
ASLKAELLSS SKPSKECEKV EFGYESLSEV IGYDKGFSEI GLPEGVMKQG LELIGGARRA  360
ELKEKXKKLH AAELDLFVKR SELIRDQAKV ILETLYYMSI KTLD
Cis-element ? help Back to Top
SourceLink
PlantRegMapXP_016648144.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016648144.10.0PREDICTED: LOW QUALITY PROTEIN: mediator-associated protein 1
TrEMBLA0A314XJQ10.0A0A314XJQ1_PRUYE; GLABROUS1 enhancer-binding protein-like
STRINGEMJ160490.0(Prunus persica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF18313490
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G61730.15e-22DNA-binding storekeeper protein-related transcriptional regulator