PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_016648084.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Amygdaleae; Prunus
Family M-type_MADS
Protein Properties Length: 349aa    MW: 39439.7 Da    PI: 7.5584
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_016648084.1genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF66.23.2e-21953145
                    S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSE CS
          SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgk 45
                    kr en+  rq t++kR++gi+KKA+ELS+LCd+++ +++fs+tgk
  XP_016648084.1  9 KRLENTNGRQATYAKRKHGIMKKANELSILCDIDIVLLMFSPTGK 53
                    689****************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004321.8E-29160IPR002100Transcription factor, MADS-box
PROSITE profilePS5006623.941153IPR002100Transcription factor, MADS-box
CDDcd002669.18E-26281No hitNo description
SuperFamilySSF554552.88E-25294IPR002100Transcription factor, MADS-box
PRINTSPR004042.6E-17323IPR002100Transcription factor, MADS-box
PfamPF003191.7E-181154IPR002100Transcription factor, MADS-box
PRINTSPR004042.6E-172338IPR002100Transcription factor, MADS-box
PRINTSPR004042.6E-173859IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010152Biological Processpollen maturation
GO:0080092Biological Processregulation of pollen tube growth
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 349 aa     Download sequence    Send to blast
MGRVKLKIKR LENTNGRQAT YAKRKHGIMK KANELSILCD IDIVLLMFSP TGKPSLCSGK  60
RSIEEVIAKF AQLTPQERAK RKLESLEALK KTFKKLDHDV NIQEFLGTSS QTIEDLTNQS  120
RLLQTQLSEI KKRLSCWSSP DKITSVEQLG QMEDSVRESL NQIRTHKENL QKQQLMSLEC  180
TSQFQNGLHI PFSMNAEQQL QPLSWIPTNE SRHMVLPEDP NLLPHRDMEC SASSSFGSYS  240
GYLGTGKSSE ISTSGQENGI LNDLSRTAPL RLQLGGQFPY LPYNLNMLTD TKFQPPAEMS  300
PQENPVEYHV NGSFEAPRPE FYPTQHSWAS TSGPCAVTMF DEHLYSQSN
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6byy_A1e-12191190MEF2 CHIMERA
6byy_B1e-12191190MEF2 CHIMERA
6byy_C1e-12191190MEF2 CHIMERA
6byy_D1e-12191190MEF2 CHIMERA
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor that forms heterodimers with the MADS-box proteins AGL66 and AGL104 and is involved in the regulation of pollen maturation at the late stages of pollen development and pollen tube growth. {ECO:0000269|PubMed:19211705}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapXP_016648084.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016648084.10.0PREDICTED: agamous-like MADS-box protein AGL30 isoform X2
SwissprotQ1PFA41e-119AGL30_ARATH; Agamous-like MADS-box protein AGL30
TrEMBLA0A251R4450.0A0A251R445_PRUPE; Uncharacterized protein
STRINGXP_008339884.10.0(Malus domestica)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G03060.21e-107AGAMOUS-like 30
Publications ? help Back to Top
  1. Zhang S, et al.
    FERTILIZATION-INDEPENDENT SEED-Polycomb Repressive Complex 2 Plays a Dual Role in Regulating Type I MADS-Box Genes in Early Endosperm Development.
    Plant Physiol., 2018. 177(1): p. 285-299
    [PMID:29523711]