PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_016648083.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Amygdaleae; Prunus
Family M-type_MADS
Protein Properties Length: 350aa    MW: 39526.8 Da    PI: 7.5584
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_016648083.1genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF66.23.2e-21953145
                    S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSE CS
          SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgk 45
                    kr en+  rq t++kR++gi+KKA+ELS+LCd+++ +++fs+tgk
  XP_016648083.1  9 KRLENTNGRQATYAKRKHGIMKKANELSILCDIDIVLLMFSPTGK 53
                    689****************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004321.8E-29160IPR002100Transcription factor, MADS-box
PROSITE profilePS5006623.941153IPR002100Transcription factor, MADS-box
CDDcd002663.56E-25282No hitNo description
SuperFamilySSF554555.62E-25295IPR002100Transcription factor, MADS-box
PRINTSPR004042.6E-17323IPR002100Transcription factor, MADS-box
PfamPF003191.7E-181154IPR002100Transcription factor, MADS-box
PRINTSPR004042.6E-172338IPR002100Transcription factor, MADS-box
PRINTSPR004042.6E-173859IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010152Biological Processpollen maturation
GO:0080092Biological Processregulation of pollen tube growth
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 350 aa     Download sequence    Send to blast
MGRVKLKIKR LENTNGRQAT YAKRKHGIMK KANELSILCD IDIVLLMFSP TGKPSLCSGK  60
RSSIEEVIAK FAQLTPQERA KRKLESLEAL KKTFKKLDHD VNIQEFLGTS SQTIEDLTNQ  120
SRLLQTQLSE IKKRLSCWSS PDKITSVEQL GQMEDSVRES LNQIRTHKEN LQKQQLMSLE  180
CTSQFQNGLH IPFSMNAEQQ LQPLSWIPTN ESRHMVLPED PNLLPHRDME CSASSSFGSY  240
SGYLGTGKSS EISTSGQENG ILNDLSRTAP LRLQLGGQFP YLPYNLNMLT DTKFQPPAEM  300
SPQENPVEYH VNGSFEAPRP EFYPTQHSWA STSGPCAVTM FDEHLYSQSN
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6byy_A3e-13192190MEF2 CHIMERA
6byy_B3e-13192190MEF2 CHIMERA
6byy_C3e-13192190MEF2 CHIMERA
6byy_D3e-13192190MEF2 CHIMERA
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor that forms heterodimers with the MADS-box proteins AGL66 and AGL104 and is involved in the regulation of pollen maturation at the late stages of pollen development and pollen tube growth. {ECO:0000269|PubMed:19211705}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapXP_016648083.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016648083.10.0PREDICTED: agamous-like MADS-box protein AGL30 isoform X1
SwissprotQ1PFA41e-122AGL30_ARATH; Agamous-like MADS-box protein AGL30
TrEMBLA0A314ZQJ30.0A0A314ZQJ3_PRUYE; Agamous-like MADS-box protein AGL30 isoform X1
STRINGXP_008339884.10.0(Malus domestica)
STRINGXP_008389454.10.0(Malus domestica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF27503370
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G03060.21e-110AGAMOUS-like 30
Publications ? help Back to Top
  1. Zhang S, et al.
    FERTILIZATION-INDEPENDENT SEED-Polycomb Repressive Complex 2 Plays a Dual Role in Regulating Type I MADS-Box Genes in Early Endosperm Development.
    Plant Physiol., 2018. 177(1): p. 285-299
    [PMID:29523711]