PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_016647930.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Amygdaleae; Prunus
Family FAR1
Protein Properties Length: 246aa    MW: 28120.4 Da    PI: 9.3034
Description FAR1 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_016647930.1genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1FAR189.93.4e-2845132290
            FAR1   2 fYneYAkevGFsvrkskskkskrngeitkrtfvCskegkreeekkktekerrtraetrtgCkaklkvkkekdgkwevtkleleHnHela 90 
                     fYn+Y+ +vGF +r+++  +sk++g+i+ rtfvC+keg+r++++++ +++ ++ra tr+gCka+l +kk + gkw+vt++ +eH+H+l+
  XP_016647930.1  45 FYNAYGMRVGFMTRMNYLARSKHDGTIIGRTFVCNKEGYRKPDRRD-KTTIKPRAPTRVGCKAMLLIKKISIGKWVVTRFMKEHTHALT 132
                     *******************************************999.999************************************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF031012.5E-2545132IPR004330FAR1 DNA binding domain
Sequence ? help Back to Top
Protein Sequence    Length: 246 aa     Download sequence    Send to blast
MSHLGQGQDD EVTQNPCKDG SSVVVEADEP YVGQEFDTEE TAQAFYNAYG MRVGFMTRMN  60
YLARSKHDGT IIGRTFVCNK EGYRKPDRRD KTTIKPRAPT RVGCKAMLLI KKISIGKWVV  120
TRFMKEHTHA LTATANKGQK GLIADQVPII NQIGQLESLD TLCICGIDMG MVKYVKFNWL  180
DGKRKIEELT RELFLERKRS ASLREIVDLL FDHIEEHSQD LSKKVQYVVG KVKEIESEGK  240
KRYNLR
Cis-element ? help Back to Top
SourceLink
PlantRegMapXP_016647930.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016647930.10.0PREDICTED: protein FAR1-RELATED SEQUENCE 5-like
TrEMBLA0A315A5A01e-140A0A315A5A0_PRUYE; Uncharacterized protein
STRINGXP_008218479.10.0(Prunus mume)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF24533072
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G59470.28e-60FAR1 family protein