PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_016647371.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Amygdaleae; Prunus
Family GATA
Protein Properties Length: 385aa    MW: 42190.5 Da    PI: 6.8629
Description GATA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_016647371.1genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GATA551.1e-17267301135
            GATA   1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkgl 35 
                     C +C t kTp+WR gp g+ktLCnaCG++y++ +l
  XP_016647371.1 267 CLHCATDKTPQWRTGPMGPKTLCNACGVRYKSGRL 301
                     99*****************************9885 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004012.0E-17261311IPR000679Zinc finger, GATA-type
PROSITE profilePS5011412.532261297IPR000679Zinc finger, GATA-type
Gene3DG3DSA:3.30.50.101.2E-14262299IPR013088Zinc finger, NHR/GATA-type
SuperFamilySSF577161.14E-15263325No hitNo description
CDDcd002021.39E-14266313No hitNo description
PfamPF003201.5E-15267301IPR000679Zinc finger, GATA-type
PROSITE patternPS003440267292IPR000679Zinc finger, GATA-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0007623Biological Processcircadian rhythm
GO:0009416Biological Processresponse to light stimulus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008270Molecular Functionzinc ion binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 385 aa     Download sequence    Send to blast
MEAPEYFQNS FCPQFTPEKR HSFDNNNNKA TNGGGGGGDH FMVEDLLDFS NDDAVITDGG  60
ATFDNVTGNS TDSSTLTVVD SCNSSSLSGS EPNVIPDIGS RNIAEGPFSS DLCVPYDDLA  120
ELEWLSNFVE ESFSSEDLQK LQLISGMKAR PDEAASETRQ FQPERNRNDN AQNTTTTNNN  180
PIFNPDVSVP AKARSKRSRA APCNWTSRLL LLSQPTSSSE QSDVVSSGPG SPLPPPSTTG  240
KKTVKSAPKK KESPEGPGGG PGEGRKCLHC ATDKTPQWRT GPMGPKTLCN ACGVRYKSGR  300
LVPEYRPASS PTFVLTKHSN SHRKVLELRR QKEMVRAQPQ FIHQVPPQQH HHHHHHHHQN  360
MVFDVSNGGD YLIHQHAGPD FRQLI
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional activator that specifically binds 5'-GATA-3' or 5'-GAT-3' motifs within gene promoters. May be involved in the regulation of some light-responsive genes (By similarity). Transcription activator involved in xylem formation. Functions upstream of NAC030/VND7, a master switch of xylem vessel differentiation (PubMed:25265867). {ECO:0000250|UniProtKB:Q8LAU9, ECO:0000269|PubMed:25265867}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00530DAPTransfer from AT5G25830Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapXP_016647371.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008220089.10.0PREDICTED: GATA transcription factor 12 isoform X1
RefseqXP_016647371.10.0PREDICTED: GATA transcription factor 12 isoform X2
SwissprotP697812e-93GAT12_ARATH; GATA transcription factor 12
TrEMBLM5Y8040.0M5Y804_PRUPE; GATA transcription factor
STRINGXP_008220089.10.0(Prunus mume)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G25830.16e-74GATA transcription factor 12
Publications ? help Back to Top
  1. Ravindran P,Verma V,Stamm P,Kumar PP
    A Novel RGL2-DOF6 Complex Contributes to Primary Seed Dormancy in Arabidopsis thaliana by Regulating a GATA Transcription Factor.
    Mol Plant, 2017. 10(10): p. 1307-1320
    [PMID:28917589]