PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_016646988.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Amygdaleae; Prunus
Family M-type_MADS
Protein Properties Length: 315aa    MW: 35614.1 Da    PI: 5.11
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_016646988.1genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF862.1e-27958150
                    S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE CS
          SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeys 50
                    k ien++nrqvt+skRrng++KKA+ELSvLCd++va+i+fs++g+l  +s
  XP_016646988.1  9 KMIENTTNRQVTYSKRRNGLIKKAYELSVLCDVDVALIMFSPSGRLSLFS 58
                    68*******************************************98776 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004322.4E-36160IPR002100Transcription factor, MADS-box
PROSITE profilePS5006628.945161IPR002100Transcription factor, MADS-box
SuperFamilySSF554559.81E-31286IPR002100Transcription factor, MADS-box
CDDcd002651.49E-36275No hitNo description
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
PRINTSPR004049.0E-25323IPR002100Transcription factor, MADS-box
PfamPF003194.3E-251155IPR002100Transcription factor, MADS-box
PRINTSPR004049.0E-252338IPR002100Transcription factor, MADS-box
PRINTSPR004049.0E-253859IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 315 aa     Download sequence    Send to blast
MGRVKLQIKM IENTTNRQVT YSKRRNGLIK KAYELSVLCD VDVALIMFSP SGRLSLFSGN  60
KSIEEILARY VNLPGHERGG RLHNQEFLQR VLVKLRREAD QTHQATSPVS TDSDQLEEIQ  120
QEILCCKSQV KEMENQLRIF EGDLSEVTTL HEAEYREQIL EETLKHLHVR KGCIYIHSTL  180
QILEEYDSSA TETTVAHAPP ATTNVDEFVT ASPHNILVDW LPQRDPQVQI LNFLNANGLL  240
PLRGEAQSRL EVIAAPQSST LLHGINLEDQ MNPGRGSGLD DENNNTTLQR PELGQVIDVN  300
LSPWNDFYQT STSFA
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3mu6_A2e-15270168Myocyte-specific enhancer factor 2A
3mu6_B2e-15270168Myocyte-specific enhancer factor 2A
3mu6_C2e-15270168Myocyte-specific enhancer factor 2A
3mu6_D2e-15270168Myocyte-specific enhancer factor 2A
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapXP_016646988.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016646988.10.0PREDICTED: agamous-like MADS-box protein AGL104
TrEMBLA0A251RC110.0A0A251RC11_PRUPE; Uncharacterized protein
STRINGXP_008220358.11e-179(Prunus mume)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF136651922
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G22130.11e-53AGAMOUS-like 104