PlantTFDB
Plant Transcription Factor Database
v5.0
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_008245989.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Amygdaleae; Prunus
Family GeBP
Protein Properties Length: 444aa    MW: 48716.7 Da    PI: 4.4961
Description GeBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_008245989.1genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF573103.41.9e-32212302497
          DUF573   4 qrlwseeDeivlLqGlidfkaktgkspsddidafyefvkksisfkvsksqlveKirrLKkKfkkkvkkaksgkepsfskehdqkifelskkiWg 97 
                      rlwse+Dei++L+G+i+++ k+g    + + af+ef+kk+++++vsk ql++KirrLK K++kk ++   g++p+fsk+h+ k+f+lskk+Wg
  XP_008245989.1 212 GRLWSEDDEIAILKGMIEYQVKNGPVTNSTMGAFHEFIKKKLQVDVSKLQLSDKIRRLKMKYQKKGEN---GEDPVFSKPHEVKSFDLSKKVWG 302
                     59**********************99999**********************************99999...**********************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF045041.9E-29213302IPR007592Protein of unknown function DUF573
Sequence ? help Back to Top
Protein Sequence    Length: 444 aa     Download sequence    Send to blast
MAPKKLLDDP PVVEDSDEET VDEETVDEEA EEEDDAVEAE DGKAKSGDDN HDGDEEEGEE  60
DADEEDEDED EEDNEEKKEK PSSKKALLTS SSAVSNSNPQ WPSASEDDSG SGSETESENN  120
SQSPSASDFT VKPIVSKPMN DTVKTNKKNA PAKPAPASNS GSKRPETEPN KKNVPSSSNS  180
GSKRRAETEP NPKDSKKKKV VNSGDDDDGK KGRLWSEDDE IAILKGMIEY QVKNGPVTNS  240
TMGAFHEFIK KKLQVDVSKL QLSDKIRRLK MKYQKKGENG EDPVFSKPHE VKSFDLSKKV  300
WGVEANGVDD NAKDSKRKPR KSNKVDKATV LALPVSDVAP VSDVAEKKEE LNVANGGIKA  360
DPVDFWSKYP CLSGSLGLDN STPRSDLTTL MIQKMPLIGK SKAKELEGKW RALQLIEMEL  420
SVKKLALMQE QAKFVLDSMK SSED
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1182198KRRAETEPNPKDSKKKK
Cis-element ? help Back to Top
SourceLink
PlantRegMapXP_008245989.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008245989.10.0PREDICTED: nucleolin-like
TrEMBLA0A251Q7900.0A0A251Q790_PRUPE; Uncharacterized protein
STRINGXP_008245989.10.0(Prunus mume)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF139661119
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G00390.12e-25DNA-binding storekeeper protein-related transcriptional regulator