PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_008245986.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Amygdaleae; Prunus
Family GRAS
Protein Properties Length: 803aa    MW: 90456.5 Da    PI: 5.4008
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_008245986.1genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS363.72.6e-1114278001373
            GRAS   1 lvelLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkfsh 95 
                     l++lL+ cA+avss+d++ +++lL+++++++spdgd  qRla++f++AL+ar+a++++++    ++ ++++++++++l+a+++   ++P+ ++s 
  XP_008245986.1 427 LRNLLILCAQAVSSNDFRTTSELLKQVRQHSSPDGDGSQRLAHFFANALEARMAGTGTGTQMFYASLASKRTSVVDTLKAYQVHLSACPFKRISL 521
                     6899***************************************************999999888999999899********************** PP

            GRAS  96 ltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..skeeleetgerLakfAeelgvpfefnvlvakrled 188
                     +  N++Il+ +e+++++Hi+Df+i +G+QWp L+q L++Rp+gpp+lRiTg++ p++g   ++ +eetg+rLak++e+++vpfe+n+++++++e+
  XP_008245986.1 522 FFKNKMILKMAEKATTLHIVDFGILYGFQWPILIQHLSKRPGGPPKLRITGIEVPQPGfrPADWIEETGRRLAKYCERFNVPFEYNAIASQNWES 616
                     *********************************************************9*9****************************999**** PP

            GRAS 189 leleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpreseeri 283
                     ++le+L+++++E+laVn++l+ ++llde+v+++ +rd+vLkl+++++P+++v++  + ++n++ F++rf eal ++sal+d+++ +++r++eer 
  XP_008245986.1 617 IKLEDLKTERNEVLAVNCMLRFKNLLDETVEVNCPRDSVLKLIRRMKPDIFVHTIVNGSYNAPFFVTRFREALFHFSALYDAFDINIARDNEERL 711
                     *********************************************************************************************** PP

            GRAS 284 kvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrpLvsvSaW 373
                     + E +  gre++nv+aceg er+er et+++W+ r ++aG++p+pl+e++ k  k  ++  + + + ++++s+++++gWk+r +++ S+W
  XP_008245986.1 712 MFESF-YGREAMNVIACEGLERVERPETYKQWQLRCTRAGLRPLPLDEDMLKIFKDKVKAWYHKDFVIDQDSDWMLQGWKGRIVYASSCW 800
                     ****9.9*******************************************************888************************* PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098563.744401781IPR005202Transcription factor GRAS
PfamPF035148.9E-109427800IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 803 aa     Download sequence    Send to blast
MDPTINGVPD YTNGFNIDAE PFLTNSTQFP NLINEYQFNQ LSPDLNFLDN HFSLPSPDLE  60
PGNFVPSISV SSDGESFVPS TSLSPDGVSF VPPMTTVSPG GDSSSDDNDF SETVFKFINQ  120
ILMEENIEKK PCMFYDPLGL RVTEKSFYDA LGQKYPSSPN QQPLYIDQNV ESPDGNFSGN  180
CSDCSGSNSN SSASPGTSNS VDPPWLGDPV DQKPFLSQTS LPNDHTFQFN SHPNSRLSVP  240
LTNDLTSVGD ELHVDNALQG SSVNEFLAQN IFTDSESILQ FNRGLEEASK FLPKDNQLVI  300
NLESKTTYPK VKRHAPTVIV KKEKSERKNS PNRSWGRKNH ERGDVAPEEE RSSKQSAVYI  360
QESELSEMFD RVLLCTEGNN ESPCDNVALQ NEASQALQSN GHPQESNGNG GKARAKKQGK  420
KKETVDLRNL LILCAQAVSS NDFRTTSELL KQVRQHSSPD GDGSQRLAHF FANALEARMA  480
GTGTGTQMFY ASLASKRTSV VDTLKAYQVH LSACPFKRIS LFFKNKMILK MAEKATTLHI  540
VDFGILYGFQ WPILIQHLSK RPGGPPKLRI TGIEVPQPGF RPADWIEETG RRLAKYCERF  600
NVPFEYNAIA SQNWESIKLE DLKTERNEVL AVNCMLRFKN LLDETVEVNC PRDSVLKLIR  660
RMKPDIFVHT IVNGSYNAPF FVTRFREALF HFSALYDAFD INIARDNEER LMFESFYGRE  720
AMNVIACEGL ERVERPETYK QWQLRCTRAG LRPLPLDEDM LKIFKDKVKA WYHKDFVIDQ  780
DSDWMLQGWK GRIVYASSCW VPA
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A2e-414318008374GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008245986.10.0PREDICTED: scarecrow-like protein 33
SwissprotQ9XE580.0SCL14_ARATH; Scarecrow-like protein 14
TrEMBLM5WK680.0M5WK68_PRUPE; Uncharacterized protein
STRINGPOPTR_0009s03800.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF13134339
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G07530.10.0SCARECROW-like 14