PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_008245457.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Amygdaleae; Prunus
Family M-type_MADS
Protein Properties Length: 209aa    MW: 23834 Da    PI: 8.9982
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_008245457.1genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF451.4e-141863247
                    ---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEE CS
          SRF-TF  2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgkly 47
                    +ie +    v+fskRr gi KKA+ + +LC+ eva++ifs++gk +
  XP_008245457.1 18 KIEKEDDLLVSFSKRRSGISKKASDMITLCGGEVAIVIFSPSGKPF 63
                    677777778**********************************955 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006621.46969IPR002100Transcription factor, MADS-box
SMARTSM004327.6E-20968IPR002100Transcription factor, MADS-box
SuperFamilySSF554551.07E-231098IPR002100Transcription factor, MADS-box
PRINTSPR004044.5E-151131IPR002100Transcription factor, MADS-box
PfamPF003199.6E-181865IPR002100Transcription factor, MADS-box
PRINTSPR004044.5E-153146IPR002100Transcription factor, MADS-box
PRINTSPR004044.5E-154667IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 209 aa     Download sequence    Send to blast
MASEGKKTRG RQRIEMKKIE KEDDLLVSFS KRRSGISKKA SDMITLCGGE VAIVIFSPSG  60
KPFSFGHPSV DAVINRFLNQ NQLENNEYTH QIMEVHQKMR IADLIQLFNE LLIQLEALKE  120
RRKLLEKISK TRGNNQEFWW NASLDELDVN ELKQTYASMA ELHMTITNHL KERRNAFDAS  180
SSSAQQTNPN FDTNPSGLGS YAFPPSYGH
Cis-element ? help Back to Top
SourceLink
PlantRegMapXP_008245457.1
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008245457.11e-156PREDICTED: agamous-like MADS-box protein AGL62
TrEMBLM5WQA41e-146M5WQA4_PRUPE; Uncharacterized protein
STRINGXP_008245457.11e-156(Prunus mume)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF12833331
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G60440.13e-36AGAMOUS-like 62