PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_008245238.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Amygdaleae; Prunus
Family GATA
Protein Properties Length: 290aa    MW: 32548.3 Da    PI: 7.314
Description GATA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_008245238.1genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GATA59.35e-19212245134
            GATA   1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkg 34 
                     C +C +tkTp+WR+gp g+ktLCnaCG++yr+ +
  XP_008245238.1 212 CMHCAVTKTPQWREGPLGPKTLCNACGVRYRSGR 245
                     99*****************************987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004013.5E-15206256IPR000679Zinc finger, GATA-type
PROSITE profilePS5011412.057206242IPR000679Zinc finger, GATA-type
SuperFamilySSF577165.7E-15208269No hitNo description
Gene3DG3DSA:3.30.50.107.3E-14210243IPR013088Zinc finger, NHR/GATA-type
CDDcd002021.50E-15211258No hitNo description
PfamPF003207.1E-17212245IPR000679Zinc finger, GATA-type
PROSITE patternPS003440212237IPR000679Zinc finger, GATA-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008270Molecular Functionzinc ion binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 290 aa     Download sequence    Send to blast
MASSMPTDDN FNIESFLPDE LKALDFPMED IEECVEDEDW YAQFQNLEPP SFEDLFCPRV  60
LDGNDDMKPK NLSTSYGQTS QRNQLPRTAA KTTRGISSIR SEDLESIGSC AAQFEPKFEK  120
RTRSKLSRSK RSSPAIFNTQ FFPSTSSNSS ASENLYHWDA SESDLEGSLT EEMSNAAKRK  180
QKKKRNLSQL SSAEMRKLSQ EEPGESRETK RCMHCAVTKT PQWREGPLGP KTLCNACGVR  240
YRSGRLFPEY RPAASPTFVA SVHSNSHKKV IELRNKGCQG ATMGILSSAQ
Cis-element ? help Back to Top
SourceLink
PlantRegMapXP_008245238.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008245237.10.0PREDICTED: GATA transcription factor 11-like isoform X1
TrEMBLA0A251NN260.0A0A251NN26_PRUPE; Uncharacterized protein
STRINGXP_008245237.10.0(Prunus mume)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G54810.23e-38GATA family protein