PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_008245237.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Amygdaleae; Prunus
Family GATA
Protein Properties Length: 309aa    MW: 34565.6 Da    PI: 7.7008
Description GATA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_008245237.1genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GATA59.25.5e-19231264134
            GATA   1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkg 34 
                     C +C +tkTp+WR+gp g+ktLCnaCG++yr+ +
  XP_008245237.1 231 CMHCAVTKTPQWREGPLGPKTLCNACGVRYRSGR 264
                     99*****************************987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004013.5E-15225275IPR000679Zinc finger, GATA-type
PROSITE profilePS5011412.057225261IPR000679Zinc finger, GATA-type
SuperFamilySSF577166.18E-15227288No hitNo description
Gene3DG3DSA:3.30.50.108.0E-14229262IPR013088Zinc finger, NHR/GATA-type
CDDcd002021.42E-15230277No hitNo description
PfamPF003207.7E-17231264IPR000679Zinc finger, GATA-type
PROSITE patternPS003440231256IPR000679Zinc finger, GATA-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008270Molecular Functionzinc ion binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 309 aa     Download sequence    Send to blast
MTAVSADVTK LTKRENISAM ASSMPTDDNF NIESFLPDEL KALDFPMEDI EECVEDEDWY  60
AQFQNLEPPS FEDLFCPRVL DGNDDMKPKN LSTSYGQTSQ RNQLPRTAAK TTRGISSIRS  120
EDLESIGSCA AQFEPKFEKR TRSKLSRSKR SSPAIFNTQF FPSTSSNSSA SENLYHWDAS  180
ESDLEGSLTE EMSNAAKRKQ KKKRNLSQLS SAEMRKLSQE EPGESRETKR CMHCAVTKTP  240
QWREGPLGPK TLCNACGVRY RSGRLFPEYR PAASPTFVAS VHSNSHKKVI ELRNKGCQGA  300
TMGILSSAQ
Cis-element ? help Back to Top
SourceLink
PlantRegMapXP_008245237.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008245237.10.0PREDICTED: GATA transcription factor 11-like isoform X1
TrEMBLA0A251NN260.0A0A251NN26_PRUPE; Uncharacterized protein
STRINGXP_008245237.10.0(Prunus mume)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF57582849
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G54810.23e-38GATA family protein