PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_008244327.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Amygdaleae; Prunus
Family GRAS
Protein Properties Length: 588aa    MW: 65700.6 Da    PI: 5.826
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_008244327.1genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS422.43.7e-1292185871373
            GRAS   1 lvelLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkfsh 95 
                     l+elL++cA a+s+++    ++l+++ +  +s +g+p+qRl ay++e+L ar   s+ ++y+a +++e +   s++ l+++++++e++P+lkf++
  XP_008244327.1 218 LKELLIACAGALSENNIDSFDKLIEKARGAVSVSGEPIQRLGAYLVEGLVARKEASGANIYRARRCREPE---SDDLLSYMQILYEICPYLKFGY 309
                     5799*****************************************************************9...9********************* PP

            GRAS  96 ltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..skeeleetgerLakfAeelgvpfefnvlvakrled 188
                     ++aN aI ea  +e+r+HiiDf+i qG+QW++LlqaLa+Rp+g+p++RiTg+++p s+  + + le++g+rL+ + e++++p+ef+  v     d
  XP_008244327.1 310 MAANGAIAEACRNEDRIHIIDFQIAQGTQWVTLLQALAARPGGAPHVRITGIDDPLSQyaRGDGLEAVGRRLKAISEKFNIPVEFHG-VPVFAPD 403
                     ******************************************************9998999**************************.6888999 PP

            GRAS 189 leleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpreseeri 283
                     ++ ++L+v++gEalaVn+ lqlh+++desv+ +++rd +L++vkslsPkv ++veqe+++n+++F++rf+ealeyy a+f+s++++lpr+++eri
  XP_008244327.1 404 VTQDMLDVRHGEALAVNFPLQLHHTPDESVDENNPRDGLLRMVKSLSPKVTTLVEQESNTNTTPFFNRFVEALEYYLAMFESIDVTLPRNNKERI 498
                     *********************************************************************************************** PP

            GRAS 284 kvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrpLvsvSaW 373
                     +vE+++l+r+ vnv+aceg+er+erhe ++kW++rl++aGF+++pls+++++ +++llr ++ + y++ +++g+++lgWkdr+L+s+SaW
  XP_008244327.1 499 NVEQHCLARDMVNVIACEGKERVERHELFGKWKSRLTMAGFQQYPLSSYVNSVIRSLLRCYS-EHYTLVDRDGAMLLGWKDRNLISASAW 587
                     **********************************************************9999.66************************* PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098564.978192569IPR005202Transcription factor GRAS
PfamPF035141.3E-126218587IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 588 aa     Download sequence    Send to blast
MDSHQHFGFG VTGAGFSYTA PHSTVPSLPT RLLGSLKFDI GNSPNSPFST HFDSDTLTTL  60
SDGQEQHSST ENLSGASPSC NSSFETNSYI HQLSFSPSVD CRRDSLQLYS GRSSLLQDAN  120
SSQNIKHALQ ELESTLMGPD NEEEEVTTLN TSFGESSKQQ TQRSTSWIQE IQEHQGSPVV  180
QRQTSFVSRQ RQLREFQIEK RYKVIDEGSL KGLPAGNLKE LLIACAGALS ENNIDSFDKL  240
IEKARGAVSV SGEPIQRLGA YLVEGLVARK EASGANIYRA RRCREPESDD LLSYMQILYE  300
ICPYLKFGYM AANGAIAEAC RNEDRIHIID FQIAQGTQWV TLLQALAARP GGAPHVRITG  360
IDDPLSQYAR GDGLEAVGRR LKAISEKFNI PVEFHGVPVF APDVTQDMLD VRHGEALAVN  420
FPLQLHHTPD ESVDENNPRD GLLRMVKSLS PKVTTLVEQE SNTNTTPFFN RFVEALEYYL  480
AMFESIDVTL PRNNKERINV EQHCLARDMV NVIACEGKER VERHELFGKW KSRLTMAGFQ  540
QYPLSSYVNS VIRSLLRCYS EHYTLVDRDG AMLLGWKDRN LISASAWH
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A6e-6124158826375GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008244327.10.0PREDICTED: scarecrow-like protein 21
SwissprotQ69VG10.0CIGR1_ORYSJ; Chitin-inducible gibberellin-responsive protein 1
TrEMBLM5X9Y90.0M5X9Y9_PRUPE; Uncharacterized protein
STRINGPOPTR_0001s44090.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF42993360
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G48150.21e-177GRAS family protein