PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_008244320.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Amygdaleae; Prunus
Family G2-like
Protein Properties Length: 439aa    MW: 48527.9 Da    PI: 7.7546
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_008244320.1genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like101.84.3e-32248301255
         G2-like   2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                     pr+rWt++LH+rFv+ave LGG+e+AtPk++lelm+vk+Ltl+hvkSHLQ+YR+
  XP_008244320.1 248 PRMRWTSTLHARFVHAVELLGGHERATPKSVLELMDVKDLTLAHVKSHLQMYRT 301
                     9****************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466892.51E-15245301IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.8E-28246301IPR009057Homeodomain-like
TIGRFAMsTIGR015571.1E-23248301IPR006447Myb domain, plants
PfamPF002498.0E-7249300IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009887Biological Processorgan morphogenesis
GO:0009944Biological Processpolarity specification of adaxial/abaxial axis
GO:0009956Biological Processradial pattern formation
GO:0010051Biological Processxylem and phloem pattern formation
GO:0010158Biological Processabaxial cell fate specification
GO:0010229Biological Processinflorescence development
GO:0048481Biological Processplant ovule development
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 439 aa     Download sequence    Send to blast
MPLEGIFIEP SSTTTSPLPD LSLHISPPNT SSSSLSIFNT TSGEPQISTT NSQAHTELSL  60
GRRFTGGAHE EPPQKPYHHH QQQSLPLYRS SNHLSHINNG VSLLDVSSSE GLRPIKGIPV  120
YQNRPFPFLP TENMIPRDHP KDSKVCFYQR PPPSYNLPSL PSASCSSNTP STPYFGGGLD  180
PMSRFNGFSS MDPFKSSNQL HHHHHLHHLH HNQYGIGGVG PISEASHHGI MRSRFLPKLP  240
TKRSMRAPRM RWTSTLHARF VHAVELLGGH ERATPKSVLE LMDVKDLTLA HVKSHLQMYR  300
TVKTTDKPAA SSDGSGEDDI LSPIGSATDL HGLRSPHQFP EQRGPSDRSS VQPDLDYTSS  360
TTLWSNSSSS REAFPHTSSH DMDGLTPVSS QLQKISGHQI QECDSTTQLK SYLGSNFETR  420
NPSLEFTLGR PDWNGKPHD
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4k_A2e-16249303458Protein PHOSPHATE STARVATION RESPONSE 1
6j4k_B2e-16249303458Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_A2e-16249303357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_B2e-16249303357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_C2e-16249303357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_D2e-16249303357Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_A2e-16249303458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_C2e-16249303458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_D2e-16249303458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_F2e-16249303458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_H2e-16249303458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_J2e-16249303458Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapXP_008244320.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC1474722e-38AC147472.18 Medicago truncatula clone mth2-24n18, complete sequence.
GenBankCR9403062e-38CR940306.3 M.truncatula DNA sequence from clone MTH2-10B11 on chromosome 3, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008244320.10.0PREDICTED: transcription repressor KAN1 isoform X1
TrEMBLA0A251Q0Z70.0A0A251Q0Z7_PRUPE; Uncharacterized protein
STRINGXP_008244320.10.0(Prunus mume)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF17563391
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G16560.18e-72G2-like family protein