PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_008244193.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Amygdaleae; Prunus
Family GRAS
Protein Properties Length: 849aa    MW: 92089 Da    PI: 6.8304
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_008244193.1genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS415.25.9e-1274778362374
            GRAS   2 velLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkfshl 96 
                      +lLl+cAeavs++++ +a+++L ++sel++p g++ qR+aayf eA++arl++s+ ++y++lpps  + +++++ ++a+++f+ +sP++kfsh+
  XP_008244193.1 477 LTLLLQCAEAVSADNFDEATKILLEISELSTPFGTSAQRVAAYFSEAMSARLVSSCLGIYASLPPSYVPISHTQKMVSAFQVFNGISPFVKFSHF 571
                     579******************************************************************************************** PP

            GRAS  97 taNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesgskeeleetgerLakfAeelgvpfefnvlvakrledlel 191
                     taNqaI ea+e+e+rvHi+D+di+qGlQWp L++ LasRp+gpp +R+Tg+g     s e+le+tg+rL++fA++lg+pfef + va+++ +l++
  XP_008244193.1 572 TANQAIQEAFEREDRVHIVDLDIMQGLQWPGLFHILASRPGGPPYVRLTGLGT----SMEALEATGKRLSDFADKLGLPFEFFP-VAEKVGSLDP 661
                     *****************************************************....***************************.7********* PP

            GRAS 192 eeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpreseerikvE 286
                     e+L+++++Ea+aV++    h+l+d ++s ++    +L+l+++l Pkvv+vveq+++h ++sFl rf+ea++yysalfdsl a++++eseer++vE
  XP_008244193.1 662 ERLNISKREAVAVHWLQ--HSLYDVTGSDSN----TLWLLQRLAPKVVTVVEQDLSH-AGSFLGRFVEAIHYYSALFDSLGASYGEESEERHVVE 749
                     ****************9..999999999999....**********************.899********************************** PP

            GRAS 287 rellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrpLvsvSaWr 374
                     ++ll+rei+nv+a  g +r  + + +++Wre+++++GF+ ++l  +aa+qa lll +++sdgy++ e++g+l lgWkd  L+++SaWr
  XP_008244193.1 750 QQLLSREIRNVLAVGGPSRSGEVK-FHNWREKFQQSGFRGISLAGNAATQATLLLGMFPSDGYTLVEDHGTLKLGWKDLCLLTASAWR 836
                     ******************888776.**************************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098561.909450816IPR005202Transcription factor GRAS
PfamPF035142.0E-124477836IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0008356Biological Processasymmetric cell division
GO:0009630Biological Processgravitropism
GO:0009956Biological Processradial pattern formation
GO:0048366Biological Processleaf development
GO:0051457Biological Processmaintenance of protein location in nucleus
GO:0090610Biological Processbundle sheath cell fate specification
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 849 aa     Download sequence    Send to blast
MAACALLGDH NGEHISGNGS SNNISHGGGS PSCPMTSTTN SNSQGSSVEQ QPPRQHQNQQ  60
QQQRQSTEGS KMVRKRMACE IEVQNYPTSR NTSASDYMRL SRRSSSIINN NPNPNATKVN  120
NNSMVYPNYS TMLLPVPSST NLTTLTSAGG ALSPASASAS SAAASAANWG PIDPLSLHHH  180
HQSGALPPHQ LQLQPKTLTP AVCGFSGLPL FPPEKTTPSN QSTATPSSIS ISMEDSSSAT  240
AWIDGIIKDL IHSSTNVSIP QLIHNVREII FPCNPNLASL LEYRLRSISE PPPPPPPIPN  300
FNPTTVPELR RRRETLQLQQ QQNQHHHHHH QGPGALKLNL DSAALHDVAI FTNPTTVETA  360
SVATHVMNSN DLYLHSWTGG GGGAGPTPIT CSQTNPHHPN SPFNQAIHHT QDKQLENSSS  420
SSPAAESTTP TAAPATTTAT TTPTPPPTTP SAAVSLIRER KEEMRQQKRD EEGLHLLTLL  480
LQCAEAVSAD NFDEATKILL EISELSTPFG TSAQRVAAYF SEAMSARLVS SCLGIYASLP  540
PSYVPISHTQ KMVSAFQVFN GISPFVKFSH FTANQAIQEA FEREDRVHIV DLDIMQGLQW  600
PGLFHILASR PGGPPYVRLT GLGTSMEALE ATGKRLSDFA DKLGLPFEFF PVAEKVGSLD  660
PERLNISKRE AVAVHWLQHS LYDVTGSDSN TLWLLQRLAP KVVTVVEQDL SHAGSFLGRF  720
VEAIHYYSAL FDSLGASYGE ESEERHVVEQ QLLSREIRNV LAVGGPSRSG EVKFHNWREK  780
FQQSGFRGIS LAGNAATQAT LLLGMFPSDG YTLVEDHGTL KLGWKDLCLL TASAWRPPFH  840
ATTNPNLHY
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A3e-494768364375GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008244193.10.0PREDICTED: protein SCARECROW-like
SwissprotQ9M3840.0SCR_ARATH; Protein SCARECROW
TrEMBLM5WLC90.0M5WLC9_PRUPE; Uncharacterized protein
STRINGVIT_08s0056g00050.t010.0(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF20683489
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G54220.10.0GRAS family protein