PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_008243919.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Amygdaleae; Prunus
Family NAC
Protein Properties Length: 356aa    MW: 40411.3 Da    PI: 8.1284
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_008243919.1genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM163.67.4e-51131401128
             NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlsk 95 
                     lp+GfrFhP+deel+v+yLk+kv++++l++ ++i+e+d+yk++Pw+Lp+k++ +e+ewyfF++rd+ky++g+r+nra+  gyWkatg+dk+++s+
  XP_008243919.1  13 LPAGFRFHPSDEELIVHYLKNKVTSSPLPA-TIITELDLYKYNPWELPAKASFGEEEWYFFTPRDRKYPNGSRPNRAAGLGYWKATGTDKHIFSS 106
                     799***************************.89***************998999****************************************9 PP

             NAM  96 .kgelvglkktLvfykgrapkgektdWvmheyrl 128
                      +++ +g+kk Lvfy+g+ pkg+kt+W+m+eyrl
  XP_008243919.1 107 cGTKSIGVKKALVFYTGHPPKGVKTEWIMNEYRL 140
                     88889***************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019413.14E-609167IPR003441NAC domain
PROSITE profilePS5100558.0913167IPR003441NAC domain
PfamPF023651.3E-2514140IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 356 aa     Download sequence    Send to blast
MEREQQTSDN IQLPAGFRFH PSDEELIVHY LKNKVTSSPL PATIITELDL YKYNPWELPA  60
KASFGEEEWY FFTPRDRKYP NGSRPNRAAG LGYWKATGTD KHIFSSCGTK SIGVKKALVF  120
YTGHPPKGVK TEWIMNEYRL LDTTMWSSKQ KGSMRLDDWV LCRVRQKCNS SRSIWEDQNS  180
PPSYKLGAYT KQADETCSKD TNPSIEMVRN YLYKDCPMLP YIFASPELPY TKTTSSISFQ  240
GSGDTKSCTK IHENDSLNKN NGPLLASSLE SLINPFKRKP AAEGNGHHQS FVTPSKRICS  300
REYQEEVSTS IGRDGCAMNS WGVDQSGSAE NNFNADQWSS MIQYQELSQL IGFQCK
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A1e-6611703171Stress-induced transcription factor NAC1
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapXP_008243919.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008243919.10.0PREDICTED: NAC transcription factor 29-like
TrEMBLM5WDR20.0M5WDR2_PRUPE; Uncharacterized protein
STRINGXP_008243919.10.0(Prunus mume)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF24162981
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G61110.19e-80NAC domain containing protein 25