PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_008243818.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Amygdaleae; Prunus
Family SBP
Protein Properties Length: 488aa    MW: 54047.3 Da    PI: 7.4122
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_008243818.1genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP132.91.1e-41163239177
                     --SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S-- CS
             SBP   1 lCqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkq 77 
                     +Cqv gC++dls+ k+yh+rh+vC++hsk+p+v+v+g+eqrfCqqCsrfh l efD+ krsCrrrLa+hnerrrk+q
  XP_008243818.1 163 TCQVFGCNMDLSSSKDYHKRHRVCDAHSKTPKVIVNGMEQRFCQQCSRFHLLAEFDDVKRSCRRRLAGHNERRRKPQ 239
                     6**************************************************************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.101.2E-32159225IPR004333Transcription factor, SBP-box
PROSITE profilePS5114132.257161238IPR004333Transcription factor, SBP-box
SuperFamilySSF1036122.09E-38163243IPR004333Transcription factor, SBP-box
PfamPF031109.6E-32164237IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010468Biological Processregulation of gene expression
GO:0042742Biological Processdefense response to bacterium
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 488 aa     Download sequence    Send to blast
MESWSFGSEG KGFLFPEEID IQIDAFARSR KPLLEWDNKT CFNFGKESVD GMEFMELDLP  60
DIVRKPFHTN QGVEILSGVV GNDSSYNSVA SPTCLISSSS SLGEGESGSK FSSPVTESNS  120
QDSSLIALKL GRLADSKNGQ NGQHSKERSK RGGIKGSYSH ISTCQVFGCN MDLSSSKDYH  180
KRHRVCDAHS KTPKVIVNGM EQRFCQQCSR FHLLAEFDDV KRSCRRRLAG HNERRRKPQL  240
DTLNCKPHKL LRSYQGAGYV GTSFAKRTPF VFSDILPGGI LYPEEYAHAN QYGNVKCEDE  300
STYSHCVTPI ANRQMLPKSV LGKQHAPGIP SSGNEYSAFD AASTIQKASG SSNSGCALSL  360
LSTQSHNLPS IIQQSTHHSV GQLYEKPSRV NSMEKCGQSG SYLRSMNSLG VDQMESVIDS  420
SQAVDFQLHT DGGFQESHCL STKYCLSPEH GTTFDLLQLS SHLQRVEHER NFLQVKQEHG  480
EYYCFPTA
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A4e-28161237884squamosa promoter binding protein-like 4
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapXP_008243818.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008243818.10.0PREDICTED: squamosa promoter-binding-like protein 6
RefseqXP_016652146.10.0PREDICTED: squamosa promoter-binding-like protein 6
TrEMBLM5XR560.0M5XR56_PRUPE; Uncharacterized protein
STRINGXP_008243818.10.0(Prunus mume)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF18193493
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G69170.16e-58SBP family protein