PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_008243583.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Amygdaleae; Prunus
Family Trihelix
Protein Properties Length: 306aa    MW: 36667.4 Da    PI: 8.8355
Description Trihelix family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_008243583.1genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1trihelix79.25.9e-2563145186
        trihelix   1 rWtkqevlaLiearremeerlrrgklkkplWeevskkmrergferspkqCkekwenlnkrykkikegekkrtsessstcpyfdqle 86 
                     +W+ qe+++L+ +r e+++++ ++k++k lWe ++ km+e+g +rs++qCk+kw+nl +ryk ++++e +     ++++p++++l+
  XP_008243583.1  63 QWSIQETKELLVIRAELDQTFMETKRNKLLWEVIATKMKEKGHHRSAEQCKCKWKNLVTRYKGCETMEPEA---MRQQFPFYNELQ 145
                     7********************************************************************95...56689*****98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
CDDcd122031.64E-2162127No hitNo description
PfamPF138373.9E-2063147No hitNo description
PROSITE profilePS500907.50364120IPR017877Myb-like domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0042802Molecular Functionidentical protein binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 306 aa     Download sequence    Send to blast
MEGHHRHHHQ QQQQPHQPLQ HQTHQLHLQQ QQQQQQQLQQ QQLQQPLPST ISVNVDASDR  60
FPQWSIQETK ELLVIRAELD QTFMETKRNK LLWEVIATKM KEKGHHRSAE QCKCKWKNLV  120
TRYKGCETME PEAMRQQFPF YNELQAIFAA RMQRMLWAEE SGAASGSKKK ALSSDEEEDN  180
EDSEAENKAS TVRKKKKKVK MSNIGIGSTS GSGSGNNVRE ILEEFMKQQM QMEMQWREEF  240
QARENERRLK EMEWRQTMEA LENERIMMER RWREREEQRR MREEARAEKR DALITALLNK  300
LRREDM
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00481DAPTransfer from AT5G01380Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008243583.10.0PREDICTED: trihelix transcription factor GT-3b
SwissprotQ9SDW04e-75TGT3A_ARATH; Trihelix transcription factor GT-3a
TrEMBLA0A0S3RUB81e-119A0A0S3RUB8_PHAAN; Uncharacterized protein
STRINGPOPTR_0006s10240.11e-118(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF17813385
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G01380.11e-54Trihelix family protein