PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_008242197.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Amygdaleae; Prunus
Family NF-YA
Protein Properties Length: 325aa    MW: 36167.5 Da    PI: 8.6001
Description NF-YA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_008242197.1genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1CBFB_NFYA1041.3e-32168224158
       CBFB_NFYA   1 deplYVNaKQyqrIlkRRqkRakleeekkldeksrkpylheSRhkhAlrRpRgsgGrF 58 
                     d p+YVNaKQy++Il+RRq+Rakle+++kl  k+rkpylheSRh hAl+R RgsgGrF
  XP_008242197.1 168 DGPIYVNAKQYHGILRRRQSRAKLEAQNKL-LKARKPYLHESRHLHALNRIRGSGGRF 224
                     57****************************.**************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005218.7E-37166227IPR001289Nuclear transcription factor Y subunit A
PROSITE profilePS5115236.988167227IPR001289Nuclear transcription factor Y subunit A
PfamPF020458.9E-28170224IPR001289Nuclear transcription factor Y subunit A
PRINTSPR006166.1E-24170192IPR001289Nuclear transcription factor Y subunit A
PROSITE patternPS006860172192IPR018362CCAAT-binding factor, conserved site
PRINTSPR006166.1E-24201224IPR001289Nuclear transcription factor Y subunit A
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0016602Cellular ComponentCCAAT-binding factor complex
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 325 aa     Download sequence    Send to blast
MPTQNLDKKF FSQSSVQSMP LYTTNCMSWN PIEREIQQSS SKDASFKVEF TPQVHHDAKH  60
LGLQLLPDQG SSSTTQTISQ SQDRCNSSES GEDEICGKGV EGQMKPVYLL NNLDLMSNPS  120
QVGYGNLMGR VPYPYADPYF SGFLAAYGPQ TMMIAPTRVP LPLDLAEDGP IYVNAKQYHG  180
ILRRRQSRAK LEAQNKLLKA RKPYLHESRH LHALNRIRGS GGRFLSTKRL QQSDQNPSSS  240
THDVPDSVNL HQKDTQDTES HHLGSSEFVT AVATHSDIAS VSHTNDIFRQ QDHRFSGIPS  300
HMGGAMQFRG GLMRAGTQHC ASVVR
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4awl_A4e-21168228262NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT ALPHA
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapXP_008242197.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008242197.10.0PREDICTED: nuclear transcription factor Y subunit A-3-like isoform X4
TrEMBLM5W4940.0M5W494_PRUPE; Uncharacterized protein
STRINGXP_008242196.10.0(Prunus mume)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G72830.15e-50nuclear factor Y, subunit A3