PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_008241802.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Amygdaleae; Prunus
Family NAC
Protein Properties Length: 335aa    MW: 38649.1 Da    PI: 4.7447
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_008241802.1genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM179.68e-5691381129
             NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpk...kvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkev 92 
                     +ppGfrFhPtdeelv +yL+kkv+++k++l +vi+++d+y++ePwdL++     ++e++ewyfFs++dkky+tg+r+nrat +g+Wkatg+dk+v
  XP_008241802.1   9 VPPGFRFHPTDEELVGYYLRKKVASQKIDL-DVIRDIDLYRIEPWDLQErcrIGYEEQNEWYFFSHKDKKYPTGTRTNRATMAGFWKATGRDKSV 102
                     69****************************.9***************953432233667************************************ PP

             NAM  93 lskkgelvglkktLvfykgrapkgektdWvmheyrle 129
                     ++ k++l+g++ktLvfykgrap+g+ktdW+mheyrle
  XP_008241802.1 103 YD-KTKLIGMRKTLVFYKGRAPNGQKTDWIMHEYRLE 138
                     **.999*****************************85 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.57E-607158IPR003441NAC domain
PROSITE profilePS5100559.6399158IPR003441NAC domain
PfamPF023653.7E-2910137IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0010200Biological Processresponse to chitin
GO:0048759Biological Processxylem vessel member cell differentiation
GO:1901348Biological Processpositive regulation of secondary cell wall biogenesis
GO:1990110Biological Processcallus formation
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 335 aa     Download sequence    Send to blast
MMESIESTVP PGFRFHPTDE ELVGYYLRKK VASQKIDLDV IRDIDLYRIE PWDLQERCRI  60
GYEEQNEWYF FSHKDKKYPT GTRTNRATMA GFWKATGRDK SVYDKTKLIG MRKTLVFYKG  120
RAPNGQKTDW IMHEYRLESE ENGPPQEEGW VVCRAFKKRT SSQNKGIEGW DSSYFYEELN  180
GVSSVVDPTE YMISRQPPSF LAQNFMCKQE TEADSLNFMH SDHFVQLPQL ESPSLPLISK  240
RPSSMSLISE NNIEVEDEPK KVTDWRALDK FVASQLSQEE RYEGDGESSF GAHDDSEMAL  300
LLLQSSGRDD DQGNKLNGFL NSSPDGDIGI CIFEK
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A1e-51816316170NO APICAL MERISTEM PROTEIN
1ut4_B1e-51816316170NO APICAL MERISTEM PROTEIN
1ut7_A1e-51816316170NO APICAL MERISTEM PROTEIN
1ut7_B1e-51816316170NO APICAL MERISTEM PROTEIN
3swm_A2e-51816319173NAC domain-containing protein 19
3swm_B2e-51816319173NAC domain-containing protein 19
3swm_C2e-51816319173NAC domain-containing protein 19
3swm_D2e-51816319173NAC domain-containing protein 19
3swp_A2e-51816319173NAC domain-containing protein 19
3swp_B2e-51816319173NAC domain-containing protein 19
3swp_C2e-51816319173NAC domain-containing protein 19
3swp_D2e-51816319173NAC domain-containing protein 19
4dul_A1e-51816316170NAC domain-containing protein 19
4dul_B1e-51816316170NAC domain-containing protein 19
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscription activator that binds to the secondary wall NAC binding element (SNBE), 5'-(T/A)NN(C/T)(T/C/G)TNNNNNNNA(A/C)GN(A/C/T)(A/T)-3', in the promoter of target genes (By similarity). Involved in xylem formation by promoting the expression of secondary wall-associated transcription factors and of genes involved in secondary wall biosynthesis and programmed cell death, genes driven by the secondary wall NAC binding element (SNBE). Triggers thickening of secondary walls (PubMed:25148240). {ECO:0000250|UniProtKB:Q9LVA1, ECO:0000269|PubMed:25148240}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00266DAPTransfer from AT2G18060Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapXP_008241802.1
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Induced by chitin (e.g. chitooctaose) (PubMed:17722694). Accumulates in plants exposed to callus induction medium (CIM) (PubMed:17581762). {ECO:0000269|PubMed:17581762, ECO:0000269|PubMed:17722694}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008241802.10.0PREDICTED: NAC domain-containing protein 37-like
RefseqXP_020423373.10.0NAC domain-containing protein 37
RefseqXP_020423374.10.0NAC domain-containing protein 37
RefseqXP_020423375.10.0NAC domain-containing protein 37
RefseqXP_020423376.10.0NAC domain-containing protein 37
RefseqXP_020423378.10.0NAC domain-containing protein 37
SwissprotQ9SL411e-157NAC37_ARATH; NAC domain-containing protein 37
TrEMBLA0A251NCH30.0A0A251NCH3_PRUPE; Uncharacterized protein
STRINGXP_008241802.10.0(Prunus mume)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF45653459
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G18060.11e-148vascular related NAC-domain protein 1
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  2. Negi S,Tak H,Ganapathi TR
    Cloning and functional characterization of MusaVND1 using transgenic banana plants.
    Transgenic Res., 2015. 24(3): p. 571-85
    [PMID:25523085]
  3. Tan TT, et al.
    Transcription Factors VND1-VND3 Contribute to Cotyledon Xylem Vessel Formation.
    Plant Physiol., 2018. 176(1): p. 773-789
    [PMID:29133368]