PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_008241780.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Amygdaleae; Prunus
Family GATA
Protein Properties Length: 403aa    MW: 43678.8 Da    PI: 6.2501
Description GATA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_008241780.1genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GATA59.16e-19318352135
            GATA   1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkgl 35 
                     Cs+Cg+ kTp+WR gp+g ktLCnaCG++y++ +l
  XP_008241780.1 318 CSHCGVQKTPQWRTGPNGAKTLCNACGVRYKSGRL 352
                     *******************************9986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004012.8E-17312366IPR000679Zinc finger, GATA-type
PROSITE profilePS5011412.426312348IPR000679Zinc finger, GATA-type
SuperFamilySSF577163.04E-14313374No hitNo description
Gene3DG3DSA:3.30.50.104.0E-15316350IPR013088Zinc finger, NHR/GATA-type
CDDcd002026.60E-15317365No hitNo description
PROSITE patternPS003440318343IPR000679Zinc finger, GATA-type
PfamPF003206.4E-17318352IPR000679Zinc finger, GATA-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008270Molecular Functionzinc ion binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 403 aa     Download sequence    Send to blast
MLYQTHHSFL FQFHPFTCSI PSSSSTTSTS TSPSTSPSLL SSLSPHPPLL LACPPPLPPQ  60
QVETEMECVE AALKTSIRKE MAVKASPQAV FDDLLWGGVN GQNGVACDDF SVDDLLDFSN  120
EDGFVETEAE EDDKDKVKGF ASVSPPKQPQ DPENSDLSDK NELGPEPTSE LSVPADDLEN  180
LEWLSHFVED SFTEFTTSLP AGFIPEKPKT EKRPDPAAPL PEKPCFKTPV PAKARSKRTR  240
TGGRVWSLGS PSLTETSSSS SSSSSSSSPS SPWLIYPTTQ NREPAEAGGE PVGSVEKPPK  300
KPKRRLVDGS SSQPPRRCSH CGVQKTPQWR TGPNGAKTLC NACGVRYKSG RLLPEYRPAC  360
SPTFSSELHS NHHRKVLEMR KKKDVTGVPE PGLTRPPVVP SFG
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1298304PKKPKRR
2298305PKKPKRRL
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008241780.10.0PREDICTED: GATA transcription factor 5-like
SwissprotQ9FH573e-91GATA5_ARATH; GATA transcription factor 5
TrEMBLM5WGI30.0M5WGI3_PRUPE; Uncharacterized protein
STRINGVIT_04s0023g02880.t011e-109(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF110834107
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G66320.21e-85GATA transcription factor 5