PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_008241202.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Amygdaleae; Prunus
Family M-type_MADS
Protein Properties Length: 215aa    MW: 23532.6 Da    PI: 9.3034
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_008241202.1genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF55.76.4e-182468145
                    S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSE CS
          SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgk 45
                    k+i+n+s  qvtfskRr+g++ KA+ L  LC+aeva+++fs++g+
  XP_008241202.1 24 KKIQNTSSLQVTFSKRRTGLFRKASQLGALCGAEVAILVFSPHGR 68
                    689***************************************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004322.6E-271675IPR002100Transcription factor, MADS-box
SuperFamilySSF554554.58E-241691IPR002100Transcription factor, MADS-box
PROSITE profilePS5006624.4041676IPR002100Transcription factor, MADS-box
PRINTSPR004043.6E-181838IPR002100Transcription factor, MADS-box
PfamPF003197.7E-222572IPR002100Transcription factor, MADS-box
PRINTSPR004043.6E-183853IPR002100Transcription factor, MADS-box
PRINTSPR004043.6E-185374IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 215 aa     Download sequence    Send to blast
MSDDSSSTVT KQRSTMGRKR IDIKKIQNTS SLQVTFSKRR TGLFRKASQL GALCGAEVAI  60
LVFSPHGRPF VFGHPSVDSA ISRLAGTSTS AECMHASGDD EETHSSIVQS NLAHSGTTYE  120
TSPDKEGLCL RLRVGGGGSM GLVKEETQEV AEAWSGGRGF WWDQPTEKMK LHELKQFKTS  180
LEDLRTKVGM QLDEMARRKL AARDFLGVYR NGSCG
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1mnm_A1e-1311001100PROTEIN (MCM1 TRANSCRIPTIONAL REGULATOR)
1mnm_B1e-1311001100PROTEIN (MCM1 TRANSCRIPTIONAL REGULATOR)
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapXP_008241202.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008241202.11e-159PREDICTED: agamous-like MADS-box protein AGL62
TrEMBLA0A314Y4431e-140A0A314Y443_PRUYE; Agamous-like MADS-box protein AGL62
STRINGXP_008241202.11e-158(Prunus mume)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF12833331
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G60440.15e-34AGAMOUS-like 62