PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_008241195.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Amygdaleae; Prunus
Family M-type_MADS
Protein Properties Length: 188aa    MW: 21363.6 Da    PI: 9.7876
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_008241195.1genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF35.71.1e-111151343
                    --SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TT CS
          SRF-TF  3 ienksnrqvtfskRrngilKKAeELSvLCdaevaviifsst 43
                    ien+s r+  f +R+  +lKK +E+S+LCd+ +  i+++++
  XP_008241195.1 11 IENDSARKKRFRRRKGSLLKKVSEISTLCDVGAFAIVYAPD 51
                    9*************************************987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004329.5E-14160IPR002100Transcription factor, MADS-box
PROSITE profilePS5006614.9149IPR002100Transcription factor, MADS-box
CDDcd002662.01E-15285No hitNo description
SuperFamilySSF554555.49E-22394IPR002100Transcription factor, MADS-box
PRINTSPR004048.2E-5323IPR002100Transcription factor, MADS-box
PfamPF003195.0E-121153IPR002100Transcription factor, MADS-box
PRINTSPR004048.2E-52338IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 188 aa     Download sequence    Send to blast
MARTKVKLAW IENDSARKKR FRRRKGSLLK KVSEISTLCD VGAFAIVYAP DSDKPDVWPS  60
PSEVKELIAK FQSIPEAERS RKMMDHETYL KETIAKLEQQ LRKIKRQNYE MEMNDIMHDL  120
YKEEKMKGIS QIMERLEKDL PLADVSSQAG RDDENVVGRS SSNGAGRKIG GIRLMGFDIG  180
SSIIAGDN
Cis-element ? help Back to Top
SourceLink
PlantRegMapXP_008241195.1
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008241195.11e-136PREDICTED: agamous-like MADS-box protein AGL80
TrEMBLA0A251N9551e-113A0A251N955_PRUPE; Uncharacterized protein
STRINGXP_008241195.11e-136(Prunus mume)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF3990322
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G28700.14e-31AGAMOUS-like 46