PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_008240912.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Amygdaleae; Prunus
Family HD-ZIP
Protein Properties Length: 351aa    MW: 38638.2 Da    PI: 8.8301
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_008240912.1genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox55.69.1e-18184238256
                     T--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
        Homeobox   2 rkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                     rk+ +++k+q   Lee F+++++++ +++  LAk+l+L  rqV vWFqNrRa+ k
  XP_008240912.1 184 RKKLRLSKDQSAFLEESFKEHSTLNPKQKLALAKQLNLRPRQVEVWFQNRRARTK 238
                     678899***********************************************98 PP

2HD-ZIP_I/II127.17.5e-41184274192
     HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreelk 92 
                     +kk+rlsk+q+++LEesF+e+++L+p++K +la++L+l+prqv+vWFqnrRARtk+kq+E+d+e+Lkr++++l+een+rL+ke +eLr +lk
  XP_008240912.1 184 RKKLRLSKDQSAFLEESFKEHSTLNPKQKLALAKQLNLRPRQVEVWFQNRRARTKLKQTEVDCEYLKRCCETLTEENRRLQKELQELR-ALK 274
                     69*************************************************************************************9.555 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF046186.5E-946146IPR006712HD-ZIP protein, N-terminal
Gene3DG3DSA:1.10.10.601.7E-17167241IPR009057Homeodomain-like
SuperFamilySSF466895.56E-18175241IPR009057Homeodomain-like
PROSITE profilePS5007117.086180240IPR001356Homeobox domain
SMARTSM003898.0E-16182244IPR001356Homeobox domain
CDDcd000861.80E-15184241No hitNo description
PfamPF000462.9E-15184238IPR001356Homeobox domain
PROSITE patternPS000270215238IPR017970Homeobox, conserved site
SMARTSM003404.5E-26240283IPR003106Leucine zipper, homeobox-associated
PfamPF021837.2E-11240274IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 351 aa     Download sequence    Send to blast
MELALSLGDA SKPFLFLDKA PKMGSKDLGF CMGLGGAFSA RSDESRESTH EGGHDQDERR  60
RRRVSSDPPV QLNLLPSAPV PRSHASSQLR FPWLTDNLAV SEPAGSSDGP GRGLDVNRMP  120
GMVAAAEEAE DAAAPLSSPN STVSSFQMDF GVGNGGRSSK RDLELETDRA SSRASDDEDN  180
GSTRKKLRLS KDQSAFLEES FKEHSTLNPK QKLALAKQLN LRPRQVEVWF QNRRARTKLK  240
QTEVDCEYLK RCCETLTEEN RRLQKELQEL RALKTSQPFY MQLPATTLTM CPSCERVVTT  300
AAANTTNNNN NSNSNSNSLK SALTKPRLHH PFAQAQVHMQ HQVQASKGAA A
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1182188TRKKLRL
2232240RRARTKLKQ
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapXP_008240912.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008240912.10.0PREDICTED: homeobox-leucine zipper protein HOX11
SwissprotP466651e-106HAT14_ARATH; Homeobox-leucine zipper protein HAT14
TrEMBLM5VQI30.0M5VQI3_PRUPE; Uncharacterized protein
STRINGXP_008240912.10.0(Prunus mume)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF23353382
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G06710.12e-83homeobox from Arabidopsis thaliana