PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_008240681.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Amygdaleae; Prunus
Family M-type_MADS
Protein Properties Length: 171aa    MW: 20100.9 Da    PI: 8.7993
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_008240681.1genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF53.23.9e-171253344
                    --SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTS CS
          SRF-TF  3 ienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstg 44
                    i n++ r+ tf kR++ i KKA ELS LCd++v++ii+  ++
  XP_008240681.1 12 IPNEIARKMTFRKRKKCIYKKADELSKLCDIDVCLIIYEADQ 53
                    889**********************************98776 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006615.222254IPR002100Transcription factor, MADS-box
SMARTSM004321.7E-9261IPR002100Transcription factor, MADS-box
PRINTSPR004043.9E-9424IPR002100Transcription factor, MADS-box
SuperFamilySSF554551.7E-17485IPR002100Transcription factor, MADS-box
CDDcd001206.53E-16449No hitNo description
PfamPF003197.3E-161254IPR002100Transcription factor, MADS-box
PRINTSPR004043.9E-92439IPR002100Transcription factor, MADS-box
PRINTSPR004043.9E-93960IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 171 aa     Download sequence    Send to blast
MPPRARRSLE LIPNEIARKM TFRKRKKCIY KKADELSKLC DIDVCLIIYE ADQKKGRAIQ  60
SETWPQDSAE FNRIFNKYKA SKDIHIPGLK QNFDLSDFFN TTKKEDVDQK FENLYPTWDD  120
RIDEFSQVEL IKLIGSLEAK IQASSKKIDS MEQNRNVSKA EEHRTNQVPD Q
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
12226RKRKK
Cis-element ? help Back to Top
SourceLink
PlantRegMapXP_008240681.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008240681.11e-124PREDICTED: agamous-like MADS-box protein AGL82
TrEMBLA0A314UT733e-84A0A314UT73_PRUYE; Agamous-like MADS-box protein AGL82
STRINGXP_008240681.11e-123(Prunus mume)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF14708511
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G55690.17e-20M-type_MADS family protein