PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_008240673.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Amygdaleae; Prunus
Family M-type_MADS
Protein Properties Length: 234aa    MW: 27534.1 Da    PI: 6.3138
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_008240673.1genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF497.7e-161253344
                    --SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTS CS
          SRF-TF  3 ienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstg 44
                    i n+  r+ tf kR++ i KKA ELS LC+++v++i++  ++
  XP_008240673.1 12 IPNEGTRKMTFRKRKKSIYKKADELSKLCGIDVCLIVYEADQ 53
                    779999*******************************98776 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006614.535262IPR002100Transcription factor, MADS-box
SMARTSM004323.6E-8261IPR002100Transcription factor, MADS-box
CDDcd001202.61E-16349No hitNo description
PRINTSPR004041.1E-6424IPR002100Transcription factor, MADS-box
SuperFamilySSF554553.79E-16685IPR002100Transcription factor, MADS-box
PfamPF003192.4E-151254IPR002100Transcription factor, MADS-box
PRINTSPR004041.1E-62439IPR002100Transcription factor, MADS-box
PRINTSPR004041.1E-63960IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 234 aa     Download sequence    Send to blast
MVAPRRRSLE LIPNEGTRKM TFRKRKKSIY KKADELSKLC GIDVCLIVYE ADQKKGRAVQ  60
PETWPRDPTQ FKRILNKYKD SKDTSTPGLK RNFDMSDFYE DKKDHVDEDD EKFQNLGKKI  120
FEEEYPTKFQ NLGKNISEEE YPTWDDRIDD FSQDELTKLI ASLESKIQVA TKKIDSMERY  180
MGFNQKQNQC FVWEDTNHDE QPAYQVPALT SPPSLVHYPM LPSAWVSRSE LEKS
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1426RRRSLELIPNEGTRKMTFRKRKK
22226RKRKK
Cis-element ? help Back to Top
SourceLink
PlantRegMapXP_008240673.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008240673.11e-175PREDICTED: agamous-like MADS-box protein AGL82
TrEMBLA0A251N6361e-151A0A251N636_PRUPE; Uncharacterized protein
STRINGXP_008240673.11e-174(Prunus mume)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF14708511
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G55690.16e-22M-type_MADS family protein