PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_008240401.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Amygdaleae; Prunus
Family G2-like
Protein Properties Length: 470aa    MW: 52192.6 Da    PI: 7.2664
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_008240401.1genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like101.45.7e-32319372255
         G2-like   2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                     pr+rWt+ LH+rFv+ave LGG+e+AtPk++lelm+vk+Ltl+hvkSHLQ+YR+
  XP_008240401.1 319 PRMRWTTSLHARFVHAVELLGGHERATPKSVLELMDVKDLTLAHVKSHLQMYRT 372
                     9****************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466892.33E-15316373IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.5E-28317373IPR009057Homeodomain-like
TIGRFAMsTIGR015573.1E-23319372IPR006447Myb domain, plants
PfamPF002492.7E-7320371IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 470 aa     Download sequence    Send to blast
MPHEKGISEA AGSCRLSLNP IPDLSLHISP PNANINKNAN SAPSSICTDH GTNEAPNHHE  60
SGSCFDIWRR DMDGDGLINK SHSDSCVRRG SCSLVAASDH DTELSLANPT ASEAESRWRK  120
NYFNTRGGGG EGRRHHLHHH EEEEEAKTSI SHGFSMLDVA ERLKPIKGIP VYNCPPTNCS  180
FPPDLEEQTH YSRVDRDQRD DFDSNKLRLY LSNSLRPAAP AANSCSGMGM GMGFESAMSR  240
TFNGITMDSP SQRQHYFPSY NLNHLQQQQQ QCSVGGVSGG ANYSYNYNSD LPSNGFIMRS  300
RFTPTKLSQN INKRNMRAPR MRWTTSLHAR FVHAVELLGG HERATPKSVL ELMDVKDLTL  360
AHVKSHLQMY RTVKNTDKPL GSSDGSGDED LLSTTTTHHH NSSTLLNQRG ASNLEHDMEH  420
HHHPSSNNLW GNSSSRGAWL QAGSMDRNGL RPEMVSHHTI TSRNQFEVVS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4r_A1e-16320374357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_B1e-16320374357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_C1e-16320374357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_D1e-16320374357Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapXP_008240401.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008240401.10.0PREDICTED: probable transcription factor KAN2 isoform X1
TrEMBLA0A251PCY00.0A0A251PCY0_PRUPE; Uncharacterized protein
STRINGXP_008240401.10.0(Prunus mume)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF17563391
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G16560.14e-38G2-like family protein