PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_008240083.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Amygdaleae; Prunus
Family SBP
Protein Properties Length: 551aa    MW: 60257.9 Da    PI: 7.317
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_008240083.1genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP132.51.4e-41177252277
                     -SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S-- CS
             SBP   2 CqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkq 77 
                     Cqv gC++dls+ k+yh+rhkvCe+hsk+++v+v+g+eqrfCqqCsrfh l efD++krsCr+rLa+hnerrrk+q
  XP_008240083.1 177 CQVYGCDKDLSSSKDYHKRHKVCEAHSKTAKVIVNGREQRFCQQCSRFHLLAEFDDGKRSCRKRLAGHNERRRKPQ 252
                     **************************************************************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.109.2E-34172238IPR004333Transcription factor, SBP-box
PROSITE profilePS5114132.359174251IPR004333Transcription factor, SBP-box
SuperFamilySSF1036121.96E-38175255IPR004333Transcription factor, SBP-box
PfamPF031108.1E-32177250IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 551 aa     Download sequence    Send to blast
MESWSRISEG KGFVSDETIS HTDSFSRSRN TLMGWELKIP CAFGSNVLVS GQQAIESQGF  60
GELGFPEMMG KHFSNNPIRD VLSGKVYGER STNTTSMATP NLFSGEDESS SKLSSSIVDS  120
NSRDSSLIDL KLGRLADNRD FHDSKFSKGH PILSSSESST PAKRMRVSGL YSQTAYCQVY  180
GCDKDLSSSK DYHKRHKVCE AHSKTAKVIV NGREQRFCQQ CSRFHLLAEF DDGKRSCRKR  240
LAGHNERRRK PQVGIHSGRA GSRFQDNMLT TASFICQEIL PSGILDAENY GTNDWCRHIK  300
VEDATHYRPL SGVPVTNGHL PLKPAFPSYD IGKRYPPFHD NGTNPLTGNI IIENGSQYSH  360
DMRGLNSGSH SMFHETTTLG SEDFNVFNTA STVHGLSGIS DSGCALSLLS SQSQKSSSHL  420
SGIPMARPLV MPVSHTNYRL VQGSENLIGG CSHASSSGVS NRFPSSGMNS GAGTHLGPIL  480
LSNGSDTDDF GISDGIFQGS DFVNAKDRLS CEDGTTIDLL QLSSQLQRVE DQRQSMQVKQ  540
ESDAFCCLRI T
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A1e-271772501184squamosa promoter binding protein-like 4
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapXP_008240083.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankLN6819323e-41LN681932.1 Cucumis melo genomic scaffold, anchoredscaffold00001.
GenBankLN7132663e-41LN713266.1 Cucumis melo genomic chromosome, chr_12.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008240083.10.0PREDICTED: squamosa promoter-binding-like protein 18
RefseqXP_008240084.10.0PREDICTED: squamosa promoter-binding-like protein 18
RefseqXP_016651143.10.0PREDICTED: squamosa promoter-binding-like protein 18
TrEMBLA0A251PBG80.0A0A251PBG8_PRUPE; Uncharacterized protein
STRINGXP_008240083.10.0(Prunus mume)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF18193493
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G69170.12e-48SBP family protein