PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_008240060.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Amygdaleae; Prunus
Family bZIP
Protein Properties Length: 176aa    MW: 20142.5 Da    PI: 7.809
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_008240060.1genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_1491.4e-1573131563
                     CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
          bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklksev 63 
                     +r +r+++NRe+ArrsR RKk++ieeL+  v++L a N++L ++l +l +  ++  +e+
  XP_008240060.1  73 RRLKRMISNRESARRSRMRKKKQIEELQYQVDQLHATNRQLSEKLIQLLEGNQQILQEN 131
                     689*********************************************99999999887 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003382.3E-1366133IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.89871134IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1707.5E-1272127No hitNo description
SuperFamilySSF579599.38E-1273124No hitNo description
PfamPF001704.0E-1473131IPR004827Basic-leucine zipper domain
CDDcd147021.16E-1574122No hitNo description
PROSITE patternPS0003607691IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 176 aa     Download sequence    Send to blast
MEPNESKGLH YLTSHSIPTQ SHPNPVHNLD SISLCPTRFF PLSHIHDFSP NTSSLSNETA  60
FDEAGEQSIN YERRLKRMIS NRESARRSRM RKKKQIEELQ YQVDQLHATN RQLSEKLIQL  120
LEGNQQILQE NAQLKERLSS LQILLADLIT PLRNVGDVTT TNTNGNRLRA EDSSTP
Cis-element ? help Back to Top
SourceLink
PlantRegMapXP_008240060.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008240060.11e-127PREDICTED: basic leucine zipper 43-like
TrEMBLM5WVR41e-121M5WVR4_PRUPE; Uncharacterized protein
STRINGXP_008240060.11e-126(Prunus mume)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF130442430
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G60830.16e-34basic leucine-zipper 70