PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_008239990.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Amygdaleae; Prunus
Family Nin-like
Protein Properties Length: 336aa    MW: 38637.6 Da    PI: 4.6893
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_008239990.1genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK841.4e-26167217252
          RWP-RK   2 ekeisledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRkiksl 52 
                     +k +s e++s+yF++pi++AAkeL+v+lT+LK++CR++GI+RWPhRk++sl
  XP_008239990.1 167 SKMLSRETISNYFYMPITQAAKELNVGLTLLKKRCRELGIRRWPHRKLASL 217
                     57899*******************************************997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5151917.803148237IPR003035RWP-RK domain
PfamPF020421.9E-21170217IPR003035RWP-RK domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0051302Biological Processregulation of cell division
Sequence ? help Back to Top
Protein Sequence    Length: 336 aa     Download sequence    Send to blast
MGGHSLMSWL ANYDVVEDPF CFTNQIVPPM DYLSGMNGYG PFDWQYERTL PLVQDSFLDA  60
VPFMDQSCLN IDPLYSSLDI QPIRSAFQGD ELVLGNGNWV CNDLFGELIE PSNNQQKQIQ  120
HQPPLLMCKN EENGSTENEL EETKVISKRS HLSTRLRSSN STSLNSSKML SRETISNYFY  180
MPITQAAKEL NVGLTLLKKR CRELGIRRWP HRKLASLQTL IRNIQDLGKE GEESEEKLRN  240
AIELLERERK LLEEVPDMQL EDNTKRLRQA CFKANYKKRK IMGMNNLDQS QSSFICSNNE  300
IHEYASIMDD GYEEDEEIKS LLSDSFSSSN SNICLF
Cis-element ? help Back to Top
SourceLink
PlantRegMapXP_008239990.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008239990.10.0PREDICTED: protein RKD1
TrEMBLA0A315A7S80.0A0A315A7S8_PRUYE; Protein RKD1
STRINGXP_008239990.10.0(Prunus mume)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF61843052
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G18790.14e-40RWP-RK domain-containing protein