PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_008239928.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Amygdaleae; Prunus
Family M-type_MADS
Protein Properties Length: 373aa    MW: 41879.2 Da    PI: 6.2473
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_008239928.1genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF72.34e-231053245
                    ---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSE CS
          SRF-TF  2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgk 45
                    + e++ nrqvtfskRrngilKKA+ELS+LCd+++ +++fs+tg+
  XP_008239928.1 10 KLESSGNRQVTFSKRRNGILKKAKELSILCDVDIVLLMFSPTGR 53
                    67999*************************************95 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004321.3E-29160IPR002100Transcription factor, MADS-box
PROSITE profilePS5006625.455153IPR002100Transcription factor, MADS-box
SuperFamilySSF554552.49E-25295IPR002100Transcription factor, MADS-box
PRINTSPR004041.4E-18323IPR002100Transcription factor, MADS-box
PfamPF003196.2E-211254IPR002100Transcription factor, MADS-box
PRINTSPR004041.4E-182338IPR002100Transcription factor, MADS-box
PRINTSPR004041.4E-183859IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010152Biological Processpollen maturation
GO:0080092Biological Processregulation of pollen tube growth
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 373 aa     Download sequence    Send to blast
MGRVKLKIKK LESSGNRQVT FSKRRNGILK KAKELSILCD VDIVLLMFSP TGRPTLLQGE  60
RSNVEEIISK FAQLTPQERA KRKLESLEAL KKTFKKLDHD VNVQEFMSSS TQTVQDLTTQ  120
VRVLQAQLTE IHKRLSFWCN PDKVDNLEHL SQMEDMLKES INRTRLHKEN LGKHQLTSLN  180
CSSQFQNGMP SSLLVGGMPE AQPLTWLLNN DNQHMILPNE SNYLPHRDVD VECSTNASVS  240
QYTSYFGTGA STSTGKQSEV GDPVQLDNMG QIPNMEGGGG LNEFDINACL STEPGQQYVY  300
PSYCSSNVDD KTLKPEMEMN LPTNPVGYQV SSDFELPRSM YDNEHHAWLS STGPSGIAVY  360
KENTYQQQPN VGL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1tqe_P1e-14192190Myocyte-specific enhancer factor 2B
1tqe_Q1e-14192190Myocyte-specific enhancer factor 2B
1tqe_R1e-14192190Myocyte-specific enhancer factor 2B
1tqe_S1e-14192190Myocyte-specific enhancer factor 2B
6c9l_A1e-14192190Myocyte-specific enhancer factor 2B
6c9l_B1e-14192190Myocyte-specific enhancer factor 2B
6c9l_C1e-14192190Myocyte-specific enhancer factor 2B
6c9l_D1e-14192190Myocyte-specific enhancer factor 2B
6c9l_E1e-14192190Myocyte-specific enhancer factor 2B
6c9l_F1e-14192190Myocyte-specific enhancer factor 2B
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor that forms a heterodimer with the MADS-box protein AGL104 and is involved in the regulation of pollen maturation at the late stages of pollen development and pollen tube growth. {ECO:0000269|PubMed:19211705}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapXP_008239928.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008239928.10.0PREDICTED: agamous-like MADS-box protein AGL65
RefseqXP_016651355.10.0PREDICTED: agamous-like MADS-box protein AGL65
SwissprotQ7X9I01e-101AGL65_ARATH; Agamous-like MADS-box protein AGL65
TrEMBLA0A314YZA00.0A0A314YZA0_PRUYE; Uncharacterized protein
STRINGXP_008239928.10.0(Prunus mume)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF27503370
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G18750.11e-103AGAMOUS-like 65
Publications ? help Back to Top
  1. Zhang S, et al.
    FERTILIZATION-INDEPENDENT SEED-Polycomb Repressive Complex 2 Plays a Dual Role in Regulating Type I MADS-Box Genes in Early Endosperm Development.
    Plant Physiol., 2018. 177(1): p. 285-299
    [PMID:29523711]