PlantTFDB
Plant Transcription Factor Database
PlantRegMap/PlantTFDB v5.0
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_008239658.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Amygdaleae; Prunus
Family LBD
Protein Properties Length: 296aa    MW: 33694.3 Da    PI: 5.1118
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_008239658.1genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260128.33.4e-40101101101
          DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaela 95 
                     aCaaCk++rrkC+++C+lap fpa+qpk f+n+hklFG+sn++k+lk+l++e + +am+s++y+A++r + PvyG+ +vi++lq ql  +++el+
  XP_008239658.1  10 ACAACKYQRRKCTPECPLAPFFPADQPKMFQNAHKLFGVSNIVKILKNLEPEMKFEAMRSIIYQANIRDKFPVYGCWEVIWQLQYQLLLAEEELQ 104
                     7********************************************************************************************** PP

          DUF260  96 llkeel 101
                     +++++l
  XP_008239658.1 105 AVQAQL 110
                     *99885 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089124.9169110IPR004883Lateral organ boundaries, LOB
PfamPF031952.5E-3810107IPR004883Lateral organ boundaries, LOB
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009556Biological Processmicrosporogenesis
GO:0009786Biological Processregulation of asymmetric cell division
GO:0005634Cellular Componentnucleus
Sequence ? help Back to Top
Protein Sequence    Length: 296 aa     Download sequence    Send to blast
MTLKGATNSA CAACKYQRRK CTPECPLAPF FPADQPKMFQ NAHKLFGVSN IVKILKNLEP  60
EMKFEAMRSI IYQANIRDKF PVYGCWEVIW QLQYQLLLAE EELQAVQAQL AMYRQHHHHQ  120
HQISSVPEYV TSQLELGMAP PNNSLPLFNH NPQPYNNNNN NAMPVTQHHH QQQSYSNSSD  180
AVYSSVYIDS KDNNAANPLW VSNPCTTNNN SNNDNSETIQ SQLGVLQPLS LQPDVQDYDE  240
LHPFFDTIDD RQSYIDSKEA YESSSEESFK DTTQSMEYAE NALKNAASCY SLTSVN
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A5e-2721134114LOB family transfactor Ramosa2.1
5ly0_B5e-2721134114LOB family transfactor Ramosa2.1
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapXP_008239658.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008239658.10.0PREDICTED: LOB domain-containing protein 27
TrEMBLM5W8G80.0M5W8G8_PRUPE; Uncharacterized protein
STRINGXP_008239658.10.0(Prunus mume)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF44152958
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G47870.19e-39LOB domain-containing protein 27