PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_008239555.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Amygdaleae; Prunus
Family ARF
Protein Properties Length: 847aa    MW: 94437.1 Da    PI: 6.9427
Description ARF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_008239555.1genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B371.51e-22160261199
                     EEEE-..-HHHHTT-EE--HHH.HTT......---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSE CS
              B3   1 ffkvltpsdvlksgrlvlpkkfaeeh......ggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrse 89 
                     f+k+lt sd++++g +++ +++a+e+      + + + +++l+ +d++ ++W++++i+r++++r++l++GW+ Fv++++L +gD ++F   + ++
  XP_008239555.1 160 FCKTLTASDTSTHGGFSVLRRHADEClppldmSRQ-PPTQELVAKDLHANEWRFRHIFRGQPRRHLLQSGWSVFVSSKRLVAGDAFIFL--RGEN 251
                     99*****************************7333.34459************************************************..4499 PP

                     E..EEEEE-S CS
              B3  90 felvvkvfrk 99 
                     +el+v+v+r+
  XP_008239555.1 252 GELRVGVRRA 261
                     99*****996 PP

2Auxin_resp115.16.1e-38286368183
      Auxin_resp   1 aahaastksvFevvYnPrastseFvvkvekvekalkvkvsvGmRfkmafetedsserrlsGtvvgvsdldpvrWpnSkWrsLk 83 
                     a+ha+ t+++F+v+Y+Pr+s++eF+v+++++++++k+++s+GmRfkm+fe+e+++e+r++Gt++g++d+d+ rW++SkWrsLk
  XP_008239555.1 286 AWHAILTGTMFTVYYKPRTSPAEFIVPFDQYMESVKNNYSIGMRFKMRFEGEEAPEQRFTGTIIGIEDADTNRWRDSKWRSLK 368
                     79*******************************************************************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.40.330.101.1E-40156275IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019365.89E-40157289IPR015300DNA-binding pseudobarrel domain
CDDcd100171.43E-20158260No hitNo description
SMARTSM010194.1E-22160262IPR003340B3 DNA binding domain
PROSITE profilePS5086311.42160262IPR003340B3 DNA binding domain
PfamPF023621.4E-20160261IPR003340B3 DNA binding domain
PfamPF065071.9E-35286368IPR010525Auxin response factor
PfamPF023091.1E-5709756IPR033389AUX/IAA domain
SuperFamilySSF542772.31E-11718797No hitNo description
PROSITE profilePS5174524.11720804IPR000270PB1 domain
PfamPF023097.5E-7766805IPR033389AUX/IAA domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0008285Biological Processnegative regulation of cell proliferation
GO:0009737Biological Processresponse to abscisic acid
GO:0009911Biological Processpositive regulation of flower development
GO:0010047Biological Processfruit dehiscence
GO:0010150Biological Processleaf senescence
GO:0010227Biological Processfloral organ abscission
GO:0045892Biological Processnegative regulation of transcription, DNA-templated
GO:0048481Biological Processplant ovule development
GO:0005634Cellular Componentnucleus
GO:0005515Molecular Functionprotein binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 847 aa     Download sequence    Send to blast
MTSSEVSIKD NCGNQRGDSF SSGFSDHNDA RNNLEGQNSH PTVSVAGRDA ETALYTELWH  60
ACAGPLVTVP RERERVFYFP QGHIEQVEAS TNQVADQQMP VYNLPSKILC RVIHVQLKAE  120
PDTDEVFAQV TLLPEPSQDE NAVEKEPPPP PPPRFQVHSF CKTLTASDTS THGGFSVLRR  180
HADECLPPLD MSRQPPTQEL VAKDLHANEW RFRHIFRGQP RRHLLQSGWS VFVSSKRLVA  240
GDAFIFLRGE NGELRVGVRR AMRQQGSAPS SVISSHSMHL GVLATAWHAI LTGTMFTVYY  300
KPRTSPAEFI VPFDQYMESV KNNYSIGMRF KMRFEGEEAP EQRFTGTIIG IEDADTNRWR  360
DSKWRSLKVR WDETSTIPRP ERVSPWKIEP ALAPPALNPL PMPRPKRPRS NMVPSSPESI  420
LTREGSSKVT ADPAMPGGFS RVLQGQEFST LRGNFVDSES DTAEKSLAWT PSVDDEKIDV  480
ISASRRYSSE NWMPSGRHEP TYTDLLSGFG TNVDSSRGIC PPFVDQAVGN SMRKHSLDQE  540
GKFNLQSWSM LPSSLSLSLD SNLKGPPIGN MAYQAQGNTR YGGFSDYSVL NGHRVDHPQG  600
NWLMPPPPSH FENPANAREV MPQHASLQKQ EVVKPKDGNY KLFGIPLIAP EAALSHRNAM  660
IGSPHHNQVH TFESDQKSDK SRGTKSVENP LAVSEPDKLL QTSQQHVRDG QVKPQGGSTR  720
SCTKVHKQGI ALGRSVDLTK FNNYKELIAA LDKLFEFDGE LMAPKKNWLI VYTDDEGDMM  780
LVGDDPWQEF CGIVRKIFIY TREEVQKMNP GTLNSHGEEN LSLVAEGADA REGKSQLLPK  840
ASTPGKC
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4ldv_A1e-1785339018354Auxin response factor 1
4ldw_A1e-1785339018354Auxin response factor 1
4ldw_B1e-1785339018354Auxin response factor 1
4ldx_A1e-1785339018354Auxin response factor 1
4ldx_B1e-1785339018354Auxin response factor 1
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtAuxin response factors (ARFs) are transcriptional factors that bind specifically to the DNA sequence 5'-TGTCTC-3' found in the auxin-responsive promoter elements (AuxREs). Could act as transcriptional activator or repressor. Formation of heterodimers with Aux/IAA proteins may alter their ability to modulate early auxin response genes expression. Promotes flowering, stamen development, floral organ abscission and fruit dehiscence. Functions independently of ethylene and cytokinin response pathways. May act as a repressor of cell division and organ growth. {ECO:0000269|PubMed:12036261, ECO:0000269|PubMed:15960614, ECO:0000269|PubMed:16176952, ECO:0000269|PubMed:16339187}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00574DAPTransfer from AT5G62000Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapXP_008239555.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008239553.10.0PREDICTED: auxin response factor 2
RefseqXP_008239554.10.0PREDICTED: auxin response factor 2
RefseqXP_008239555.10.0PREDICTED: auxin response factor 2
SwissprotQ94JM30.0ARFB_ARATH; Auxin response factor 2
TrEMBLA0A2L1GH100.0A0A2L1GH10_9ROSA; Auxin response factor (Fragment)
STRINGXP_008239553.10.0(Prunus mume)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G62000.30.0auxin response factor 2
Publications ? help Back to Top
  1. Chao WS,Doğramaci M,Foley ME,Horvath DP,Anderson JV
    Selection and validation of endogenous reference genes for qRT-PCR analysis in leafy spurge (Euphorbia esula).
    PLoS ONE, 2012. 7(8): p. e42839
    [PMID:22916167]
  2. Ozerova LV,Krasnikova MS,Troitsky AV,Solovyev AG,Morozov SY
    TAS3 Genes for small ta-siARF RNAs in plants belonging to subtribe Senecioninae: occurrence of prematurely terminated RNA precursors.
    Mol. Gen. Mikrobiol. Virusol., 2013.
    [PMID:24003511]
  3. Li C, et al.
    Ectopic expression of a maize hybrid down-regulated gene ZmARF25 decreases organ size by affecting cellular proliferation in Arabidopsis.
    PLoS ONE, 2014. 9(4): p. e94830
    [PMID:24756087]
  4. Lyons R, et al.
    Fusarium oxysporum triggers tissue-specific transcriptional reprogramming in Arabidopsis thaliana.
    PLoS ONE, 2015. 10(4): p. e0121902
    [PMID:25849296]
  5. Roodbarkelari F,Du F,Truernit E,Laux T
    ZLL/AGO10 maintains shoot meristem stem cells during Arabidopsis embryogenesis by down-regulating ARF2-mediated auxin response.
    BMC Biol., 2015. 13: p. 74
    [PMID:26358077]
  6. Meng LS,Wang ZB,Yao SQ,Liu A
    The ARF2-ANT-COR15A gene cascade regulates ABA-signaling-mediated resistance of large seeds to drought in Arabidopsis.
    J. Cell. Sci., 2015. 128(21): p. 3922-32
    [PMID:26395398]
  7. Zhao S,Zhang ML,Ma TL,Wang Y
    Phosphorylation of ARF2 Relieves Its Repression of Transcription of the K+ Transporter Gene HAK5 in Response to Low Potassium Stress.
    Plant Cell, 2016. 28(12): p. 3005-3019
    [PMID:27895227]
  8. Promchuea S,Zhu Y,Chen Z,Zhang J,Gong Z
    ARF2 coordinates with PLETHORAs and PINs to orchestrate ABA-mediated root meristem activity in Arabidopsis .
    J Integr Plant Biol, 2017. 59(1): p. 30-43
    [PMID:28074634]
  9. Wójcikowska B,Gaj MD
    Expression profiling of AUXIN RESPONSE FACTOR genes during somatic embryogenesis induction in Arabidopsis.
    Plant Cell Rep., 2017. 36(6): p. 843-858
    [PMID:28255787]
  10. Sanz-Fernández M, et al.
    Screening Arabidopsis mutants in genes useful for phytoremediation.
    J. Hazard. Mater., 2017. 335: p. 143-151
    [PMID:28441590]
  11. Zhang M,Hu X,Zhu M,Xu M,Wang L
    Transcription factors NF-YA2 and NF-YA10 regulate leaf growth via auxin signaling in Arabidopsis.
    Sci Rep, 2017. 7(1): p. 1395
    [PMID:28469131]
  12. Guan C, et al.
    Spatial Auxin Signaling Controls Leaf Flattening in Arabidopsis.
    Curr. Biol., 2017. 27(19): p. 2940-2950.e4
    [PMID:28943086]
  13. Liu Z, et al.
    ARF2-ARF4 and ARF5 are Essential for Female and Male Gametophyte Development in Arabidopsis.
    Plant Cell Physiol., 2018. 59(1): p. 179-189
    [PMID:29145642]
  14. Sarkar Das S, et al.
    Expression dynamics of miRNAs and their targets in seed germination conditions reveals miRNA-ta-siRNA crosstalk as regulator of seed germination.
    Sci Rep, 2018. 8(1): p. 1233
    [PMID:29352229]