PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_008239527.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Amygdaleae; Prunus
Family NAC
Protein Properties Length: 233aa    MW: 26289.5 Da    PI: 8.4734
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_008239527.1genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM157.74.7e-49141381128
             NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlsk 95 
                     lppGfrF+Ptdeelv +yL+ kv + +l++ ++i+ev+++ ++PwdLp      e+e yfFs++++ky++g+r+nr+t+sgyWkatg+dk+++s+
  XP_008239527.1  14 LPPGFRFQPTDEELVFQYLRCKVFSCPLPA-SIIPEVNVCMYDPWDLPGD---LEQERYFFSNKESKYRNGSRANRVTSSGYWKATGTDKKIVSS 104
                     79****************************.89***************54...46799**********************************998 PP

             NAM  96 .kgelvglkktLvfykgrapkgektdWvmheyrl 128
                      +++ vg kktLvfy+g+ap+g +tdWvmhey l
  XP_008239527.1 105 rRNHIVGKKKTLVFYRGKAPNGCRTDWVMHEYCL 138
                     67778***************************87 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.09E-578168IPR003441NAC domain
PROSITE profilePS5100554.93914168IPR003441NAC domain
PfamPF023651.0E-2415138IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 233 aa     Download sequence    Send to blast
MDKFNFVRNG MIRLPPGFRF QPTDEELVFQ YLRCKVFSCP LPASIIPEVN VCMYDPWDLP  60
GDLEQERYFF SNKESKYRNG SRANRVTSSG YWKATGTDKK IVSSRRNHIV GKKKTLVFYR  120
GKAPNGCRTD WVMHEYCLVD AETTTSINTA ENALNQKENW VLCRIFSKKR SCKTDDEKGI  180
RVNNAEMVHA PQTNNNQSPV SSSSSCSSSS GITEVTSSSG AGDEEEISGC TKF
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A2e-471217315170NO APICAL MERISTEM PROTEIN
1ut4_B2e-471217315170NO APICAL MERISTEM PROTEIN
1ut7_A2e-471217315170NO APICAL MERISTEM PROTEIN
1ut7_B2e-471217315170NO APICAL MERISTEM PROTEIN
4dul_A2e-471217315170NAC domain-containing protein 19
4dul_B2e-471217315170NAC domain-containing protein 19
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional repressor that negatively regulates the expression of genes involved in xylem vessel formation. Represses the transcriptional activation activity of NAC030/VND7, which regulates protoxylem vessel differentiation by promoting immature xylem vessel-specific genes expression (PubMed:20388856). Transcriptional activator that regulates the COLD-REGULATED (COR15A and COR15B) and RESPONSIVE TO DEHYDRATION (LTI78/RD29A and LTI65/RD29B) genes by binding directly to their promoters. Mediates signaling crosstalk between salt stress response and leaf aging process (PubMed:21673078). May play a role in DNA replication of mungbean yellow mosaic virus (PubMed:24442717). {ECO:0000269|PubMed:20388856, ECO:0000269|PubMed:21673078, ECO:0000269|PubMed:24442717}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapXP_008239527.1
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: By abscisic acid (ABA) and salt stress. {ECO:0000269|PubMed:21673078}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008239527.11e-176PREDICTED: NAC domain-containing protein 83
SwissprotQ9FY938e-77NAC83_ARATH; NAC domain-containing protein 83
TrEMBLA0A251PA181e-163A0A251PA18_PRUPE; Uncharacterized protein
STRINGXP_008239527.11e-175(Prunus mume)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF70434139
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G13180.11e-78NAC domain containing protein 83
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  2. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]