PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_008238376.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Amygdaleae; Prunus
Family GATA
Protein Properties Length: 542aa    MW: 60147.7 Da    PI: 7.2564
Description GATA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_008238376.1genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GATA49.84.5e-16741135
            GATA  1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkgl 35
                    C +Cg+t+TplWR+gp  ++ LCnaCG ++r kg+
  XP_008238376.1  7 CYHCGVTSTPLWRNGPPDKPVLCNACGSRWRTKGT 41
                    ****************55555***********997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004011.2E-9155IPR000679Zinc finger, GATA-type
SuperFamilySSF577162.04E-11545No hitNo description
CDDcd002021.08E-16654No hitNo description
PROSITE profilePS5011411.345740IPR000679Zinc finger, GATA-type
PfamPF003207.0E-14741IPR000679Zinc finger, GATA-type
Gene3DG3DSA:3.30.50.102.0E-12741IPR013088Zinc finger, NHR/GATA-type
PfamPF139191.5E-11282373IPR028020ASX homology domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008270Molecular Functionzinc ion binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 542 aa     Download sequence    Send to blast
MGKQGPCYHC GVTSTPLWRN GPPDKPVLCN ACGSRWRTKG TLANYTPLHA RAEPDDYEDH  60
RVSRVKSISI NKNKEIKLVK RKQNPDSVMV GGVAADYAHG FRKVTDEDTS NRSSSGSAVS  120
NSESCAQFGS ADASDLTGPA QSMVWDSMVP SRKRTCIGRP KPSPVEKLTK DLYTILHEQQ  180
SSYFSGSSEE DLLFECETPM VSVEIGHGSV LMRHPSSITR EEESEASSLS VDNKQCHINE  240
AYSHPATLLV HNNKGVIMTS TVTGKMNNLA GQGMQQEPPK RDKSQYDNFQ ILGNHNSPLC  300
HVDLNDILNF EEFTRQLTNE EQQQLLKHLP PVDVVKFPYS LKSMFDNPQF RENLTSFQQL  360
LAEGVFDISF LGAKTEDCKT LKRLVLSNSS KSKWVERYHL LKKCKTSPGK SVISGPNALA  420
SSNFRHVKRL RDSETQSFPD VKMMMKSPKR IIVKGSNENK DLMDYDGSCF SPRSLFALPA  480
DGSSLLMESM NFVDESSDQD LLLDLPSNGS FAQAELLHPA MSFGAQQAST SSSSIYPHIL  540
HP
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional regulator that specifically binds 5'-GATA-3' or 5'-GAT-3' motifs within gene promoters. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapXP_008238376.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008238376.10.0PREDICTED: GATA transcription factor 26
SwissprotQ8W4H11e-161GAT26_ARATH; GATA transcription factor 26
TrEMBLM5WBH50.0M5WBH5_PRUPE; Uncharacterized protein
STRINGXP_008238376.10.0(Prunus mume)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF44243155
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G17570.31e-151GATA transcription factor 26