PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_008238229.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Amygdaleae; Prunus
Family GRAS
Protein Properties Length: 478aa    MW: 53175.7 Da    PI: 5.9328
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_008238229.1genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS303.93.9e-93584752373
            GRAS   2 velLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlar.svselykalppsetseknsseelaalkl..fsevsPilkf 93 
                     ++lL++cA+a++++d++laq++L+ l+++a +dgd++qRl+  f++AL ar ar  + +l +a++ s+++ + +++++++ +l  f +++P+++f
  XP_008238229.1  58 EQLLVHCANAIETNDATLAQQILWVLNNIAPQDGDSNQRLTCAFLRALIARAARiGSCKLLAAMANSQANFTIHTHKFSVIELasFIDLTPWHRF 152
                     79****************************************************5445677777777777666777777777788********** PP

            GRAS  94 shltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRp...egppslRiTgvgspesg...skeeleetgerLakfAeelgvpfefnvl. 181
                     ++ +aN aIleaveg + +Hi+D+++++++Q p+L +a+a R+    +pp l++T+ gs e +      ++ee+g++L +fA++ ++ +ef+v+ 
  XP_008238229.1 153 GFTAANAAILEAVEGYSVIHIVDLSLTHCMQIPTLVDAIAGRQeanVSPPLLKLTVAGSTEDVppmLDLSYEELGSKLVNFARSRNIILEFRVIp 247
                     ******************************************9766679**********888798888999***********************8 PP

            GRAS 182 ......vakrledleleeLrvkp.gEalaVnlvlqlhrll...............................desvsleserdevLklvkslsPkv 238
                            a+ +++l++++L   + gEal+Vn++++lh+++                               +++ +++s r+ +Lk++++l P++
  XP_008238229.1 248 ssytdgFANLIQQLRVQNLVYAEsGEALVVNCHMMLHYIPeetltlpsinsnpnltscgssssygydvassSSTSTSSSLRTMFLKALRGLDPTI 342
                     885555555555556666655559********************************************9965555556699************** PP

            GRAS 239 vvvveqeadhnsesFlerflealeyysalfdsleaklpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplseka 333
                     vv+v+++ad++s++++ r+ +a++y +  +d++++ lpr s++r+++E+  + ++i+nv+a eg++r+er e + +W +r+++a F++v+++e+a
  XP_008238229.1 343 VVLVDEDADLTSNNLVCRLRSAFNYLWIPYDTVDTFLPRGSKQRQWYEAD-MCWKIENVIAYEGFQRVERVEPKCRWVQRMRNANFRSVSFGEDA 436
                     **************************************************.9******************************************* PP

            GRAS 334 akqaklllrkvksdgyrveeesgslvlgWkdrpLvsvSaW 373
                     + ++k++l +++  g+ ++ e++ +vl+Wk++++v+++aW
  XP_008238229.1 437 VLEVKAMLDEHA-AGWGLKREEEDVVLTWKGHNVVFATAW 475
                     ************.8999*********************** PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098543.10131457IPR005202Transcription factor GRAS
PfamPF035141.4E-9058475IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 478 aa     Download sequence    Send to blast
MMQFTEAPPP ALHQIITAPF SNLPMINKNQ THRTRPWPGF PTSAKALGTN FGDANCMEQL  60
LVHCANAIET NDATLAQQIL WVLNNIAPQD GDSNQRLTCA FLRALIARAA RIGSCKLLAA  120
MANSQANFTI HTHKFSVIEL ASFIDLTPWH RFGFTAANAA ILEAVEGYSV IHIVDLSLTH  180
CMQIPTLVDA IAGRQEANVS PPLLKLTVAG STEDVPPMLD LSYEELGSKL VNFARSRNII  240
LEFRVIPSSY TDGFANLIQQ LRVQNLVYAE SGEALVVNCH MMLHYIPEET LTLPSINSNP  300
NLTSCGSSSS YGYDVASSSS TSTSSSLRTM FLKALRGLDP TIVVLVDEDA DLTSNNLVCR  360
LRSAFNYLWI PYDTVDTFLP RGSKQRQWYE ADMCWKIENV IAYEGFQRVE RVEPKCRWVQ  420
RMRNANFRSV SFGEDAVLEV KAMLDEHAAG WGLKREEEDV VLTWKGHNVV FATAWMPA
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5b3g_B8e-415247782474Protein SHORT-ROOT
5b3h_B3e-415347729420Protein SHORT-ROOT
5b3h_E3e-415347729420Protein SHORT-ROOT
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor involved in plant development. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapXP_008238229.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008238229.10.0PREDICTED: scarecrow-like protein 32
SwissprotQ9SN221e-180SCL32_ARATH; Scarecrow-like protein 32
TrEMBLM5VYZ60.0M5VYZ6_PRUPE; Uncharacterized protein
STRINGXP_008238229.10.0(Prunus mume)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF77023347
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G49950.11e-176GRAS family protein