PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_008237527.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Amygdaleae; Prunus
Family NAC
Protein Properties Length: 432aa    MW: 48183 Da    PI: 4.2879
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_008237527.1genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM154.35.4e-4861341129
             NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp.k.kvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevl 93 
                     l+pGfrF+Ptd elv++yLk+++ gk+l + +vi+evdiyk++PwdLp k + + ++ +wyfF++r+kky++g+r +rat+ gyWk+tgkd++vl
  XP_008237527.1   6 LAPGFRFKPTDVELVQYYLKRRLLGKRLGF-KVIAEVDIYKYDPWDLPdKsCWDCGDLKWYFFCPREKKYRSGNRVQRATEGGYWKTTGKDRSVL 99 
                     579************************999.99**************96345666888************************************* PP

             NAM  94 skkgelvglkktLvfykgrapkgektdWvmheyrle 129
                       +g+ vg  ktL+f++grap+g +t+Wvmheyrle
  XP_008237527.1 100 Y-SGAIVGWIKTLIFHTGRAPSGDRTNWVMHEYRLE 134
                     *.999*****************************85 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019412.35E-573156IPR003441NAC domain
PROSITE profilePS5100554.5976156IPR003441NAC domain
PfamPF023659.1E-258133IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 432 aa     Download sequence    Send to blast
MGKSSLAPGF RFKPTDVELV QYYLKRRLLG KRLGFKVIAE VDIYKYDPWD LPDKSCWDCG  60
DLKWYFFCPR EKKYRSGNRV QRATEGGYWK TTGKDRSVLY SGAIVGWIKT LIFHTGRAPS  120
GDRTNWVMHE YRLEDQGLAD RGVPLDSYVL CMIFQKEGLG PRIGAQYGAP FKEEDWSDDE  180
VEITSEAVQV AITPEPDLGL PCNYVSPTAT NAHSVGDIGV GPSGSGIYDI LPPFCEVSQP  240
VSSNYVILEM PLASVGDDII SMFDCFTEES ALYTDEPKKV EAEGRLETVQ NANMPSTHSP  300
EVIGVGPSFE SCGFDVLPPC NVNESVSCNF VTMENPPASN GVETLPIMDC FAEESMLFVN  360
DNGKNEELNN LEHLGNATPH FNTSNIYEDL GDLENLGRVG EVGYNFCSEP DSRSHFLELY  420
DLDQPQHPNL FF
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A1e-44515716166NO APICAL MERISTEM PROTEIN
1ut4_B1e-44515716166NO APICAL MERISTEM PROTEIN
1ut7_A1e-44515716166NO APICAL MERISTEM PROTEIN
1ut7_B1e-44515716166NO APICAL MERISTEM PROTEIN
4dul_A1e-44515716166NAC domain-containing protein 19
4dul_B1e-44515716166NAC domain-containing protein 19
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional regulator that binds specific DNA sequences on the promoter regions of target genes. {ECO:0000250|UniProtKB:Q9C8W9}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00583DAPTransfer from AT5G64060Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapXP_008237527.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008237527.10.0PREDICTED: NAC domain-containing protein 82-like
SwissprotQ9FY825e-87NAC82_ARATH; NAC domain-containing protein 82
TrEMBLM5VM480.0M5VM48_PRUPE; Uncharacterized protein
STRINGXP_008237527.10.0(Prunus mume)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF33023465
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G64060.17e-89NAC domain containing protein 103
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  2. Deeken R, et al.
    Identification of Arabidopsis thaliana phloem RNAs provides a search criterion for phloem-based transcripts hidden in complex datasets of microarray experiments.
    Plant J., 2008. 55(5): p. 746-59
    [PMID:18485061]
  3. Ohbayashi I, et al.
    Evidence for a Role of ANAC082 as a Ribosomal Stress Response Mediator Leading to Growth Defects and Developmental Alterations in Arabidopsis.
    Plant Cell, 2017. 29(10): p. 2644-2660
    [PMID:28899981]