PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_008237479.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Amygdaleae; Prunus
Family GRF
Protein Properties Length: 615aa    MW: 66594.4 Da    PI: 7.1794
Description GRF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_008237479.1genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRC76.62.6e-24241285145
             WRC   1 daepgrCrRtDGKkWRCsrrvlegkklCErHlhrgrsrsrkskee 45 
                     d+epgrCrRtDGKkWRCsr++++++k+CErH++rgr+rsrk++e 
  XP_008237479.1 241 DPEPGRCRRTDGKKWRCSRDAVADQKYCERHINRGRHRSRKPVEG 285
                     79****************************************985 PP

2QLQ58.32.3e-20172208137
             QLQ   1 saFTaaQlqlLksQilAyKyLaanqPvPpeLlqaiqk 37 
                     ++FT++Q+ +L++Q+l+yKy+ +n+PvP++Ll +++k
  XP_008237479.1 172 GPFTPSQWIELEHQALIYKYMTSNVPVPSNLLIPLKK 208
                     59*******************************9975 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM009511.6E-11172208IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166622.429173208IPR014978Glutamine-Leucine-Glutamine, QLQ
PfamPF088804.4E-14173206IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166725.287241285IPR014977WRC domain
PfamPF088797.9E-21242284IPR014977WRC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009624Biological Processresponse to nematode
GO:0048364Biological Processroot development
GO:0048366Biological Processleaf development
GO:0061062Biological Processregulation of nematode larval development
GO:0005634Cellular Componentnucleus
GO:0005524Molecular FunctionATP binding
Sequence ? help Back to Top
Protein Sequence    Length: 615 aa     Download sequence    Send to blast
MDFGVMGLEG LVGPEGGATG AAHSMASDPE TKPKGHAPNV PHGSGSVKQQ RSWPAEDDWR  60
TSKMPKNDNL PAPKTMPLQY QGTXXXXXXX XXXXXXADTH RQEQMLSFSN NKSEVTFLSK  120
DGMLERNIQG PDFAYYQRTP ALTPSAYTRN AAAYGSGTIN PSMHGPFAGV RGPFTPSQWI  180
ELEHQALIYK YMTSNVPVPS NLLIPLKKSL YPYGLSGSTG NLAPNSLAWG SYHLGFSGNT  240
DPEPGRCRRT DGKKWRCSRD AVADQKYCER HINRGRHRSR KPVEGQPGQA ASGTGNSKGV  300
PMTSSTSTPV MPSSGTSNNV ATMQNQFKSL QPAGAANPSA DAFVNRMQDP RDLSVMSAST  360
IKPKASDSRF NMPKQEIPLE ESSQSEFGLV STDSLLNPSH RNSYISKDFG GSFLDFSDQE  420
AQDQHPLRQF IDDWPKDQSS HSVSTWPDEI KSDWTQLSMS IPMTSSEFSS SSSSPTQEKR  480
ALSPLRLSRE FEPAQMNLGG SNEHSESSQK TNWIPIPWGN SMGGPLGEVL TNTTSSGKMC  540
NNSVSPLNLL NEGWDGSPQL GSSPTGVLQK STFCSLSNSS SGSSPRGENK KNLDGASIYD  600
DVLGSTFASS SVPSL
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008237479.10.0PREDICTED: growth-regulating factor 1
TrEMBLM5W6960.0M5W696_PRUPE; Uncharacterized protein
STRINGVIT_00s0494g00010.t010.0(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF20853481
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G22840.11e-100growth-regulating factor 1