PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_008236856.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Amygdaleae; Prunus
Family GATA
Protein Properties Length: 325aa    MW: 35338.4 Da    PI: 5.1258
Description GATA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_008236856.1genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GATA57.81.5e-18244277134
            GATA   1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkg 34 
                     Cs+C++ kTp+WR gp g ktLCnaCG+++++ +
  XP_008236856.1 244 CSHCHVQKTPQWRTGPLGAKTLCNACGVRFKSGR 277
                     *******************************987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PIRSFPIRSF0169924.3E-865318IPR016679Transcription factor, GATA, plant
SuperFamilySSF577161.19E-13238299No hitNo description
SMARTSM004011.6E-14238292IPR000679Zinc finger, GATA-type
Gene3DG3DSA:3.30.50.102.5E-14242275IPR013088Zinc finger, NHR/GATA-type
PROSITE profilePS5011411.253242274IPR000679Zinc finger, GATA-type
CDDcd002022.07E-14243292No hitNo description
PfamPF003202.1E-16244277IPR000679Zinc finger, GATA-type
PROSITE patternPS003440244269IPR000679Zinc finger, GATA-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008270Molecular Functionzinc ion binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 325 aa     Download sequence    Send to blast
MELCMEAKAL KSSLRSELAL KSNQQALIDE FWCATGISGV PSEDFSVDDL LDLSNGEFED  60
GSVEEEEEEE KDSVSVDDES SNSSNFVSAD SESSLASQLL VPDDDLAGLE WVSHFVDDSM  120
LDLSLLHPVG TQKPEALALT RSEAEAKLVQ STPTWFPSQV PVKPRTKRCR AASRVWSYPS  180
SSSPSSSSSC SSGFSFSTPC LIFNNPVQST DVLVGEPATK KQKKKPAVQT GADGSVGVQF  240
QRRCSHCHVQ KTPQWRTGPL GAKTLCNACG VRFKSGRLFP EYRPACSPTF SGDVHSNSHR  300
KVLEMRKRKE AGGPEPGLNR VIPSF
Cis-element ? help Back to Top
SourceLink
PlantRegMapXP_008236856.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008236855.10.0PREDICTED: GATA transcription factor 5-like
RefseqXP_008236856.10.0PREDICTED: GATA transcription factor 5-like
TrEMBLA0A314Y1V40.0A0A314Y1V4_PRUYE; GATA transcription factor
STRINGXP_008236855.10.0(Prunus mume)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G66320.21e-57GATA transcription factor 5