PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_008236239.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Amygdaleae; Prunus
Family M-type_MADS
Protein Properties Length: 240aa    MW: 27013.8 Da    PI: 9.1079
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_008236239.1genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF69.92.3e-221962245
                    ---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSE CS
          SRF-TF  2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgk 45
                    +ie  sn qvtfskRr g++KKA+EL++LC++e+a+i+fs+ +k
  XP_008236239.1 19 KIEKRSNLQVTFSKRRSGLFKKASELCTLCGVEIAIIVFSPANK 62
                    699**************************************998 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006623.6191070IPR002100Transcription factor, MADS-box
SMARTSM004322.7E-311069IPR002100Transcription factor, MADS-box
CDDcd002656.32E-341178No hitNo description
SuperFamilySSF554551.44E-261183IPR002100Transcription factor, MADS-box
PRINTSPR004045.0E-181232IPR002100Transcription factor, MADS-box
PfamPF003191.1E-251966IPR002100Transcription factor, MADS-box
PRINTSPR004045.0E-183247IPR002100Transcription factor, MADS-box
PRINTSPR004045.0E-184768IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 240 aa     Download sequence    Send to blast
MVIKIKKASQ GRQKIAIAKI EKRSNLQVTF SKRRSGLFKK ASELCTLCGV EIAIIVFSPA  60
NKPFSFGHPE VDSIVDRFIA RNPNPNPLGL AWSTDTTQEL AEAHRNSNVH ELNKQLTQIV  120
NQLEAERKQG EALDKMSKAS QNQCWWEMPV DELGLHELQI LKASVEELKR NVNKQANRIL  180
MESSYPSAAA NYSSSPLSMM KNIGGLVQRD IDDHYRFESK NPTDQIEPAY NFGYAGHGLF
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3kov_A3e-151182172Myocyte-specific enhancer factor 2A
3kov_B3e-151182172Myocyte-specific enhancer factor 2A
3kov_I3e-151182172Myocyte-specific enhancer factor 2A
3kov_J3e-151182172Myocyte-specific enhancer factor 2A
3p57_A3e-151182172Myocyte-specific enhancer factor 2A
3p57_B3e-151182172Myocyte-specific enhancer factor 2A
3p57_C3e-151182172Myocyte-specific enhancer factor 2A
3p57_D3e-151182172Myocyte-specific enhancer factor 2A
3p57_I3e-151182172Myocyte-specific enhancer factor 2A
3p57_J3e-151182172Myocyte-specific enhancer factor 2A
5f28_A3e-151182273MEF2C
5f28_B3e-151182273MEF2C
5f28_C3e-151182273MEF2C
5f28_D3e-151182273MEF2C
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapXP_008236239.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008236239.10.0PREDICTED: agamous-like MADS-box protein AGL62
TrEMBLA0A1L5YEJ21e-170A0A1L5YEJ2_PRUPE; MADS-box protein 21
STRINGXP_008236239.11e-180(Prunus mume)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF12833331
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G60440.14e-57AGAMOUS-like 62