PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_008236215.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Amygdaleae; Prunus
Family M-type_MADS
Protein Properties Length: 478aa    MW: 51484.7 Da    PI: 4.5311
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_008236215.1genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF63.71.9e-201658345
                    --SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSE CS
          SRF-TF  3 ienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgk 45
                     en++n qvtfskRr+g++KKA+ELS+LC++e  +i+fs+  k
  XP_008236215.1 16 MENETNLQVTFSKRRAGLFKKASELSTLCGTELGLIVFSPGKK 58
                    69*************************************9765 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006623.436666IPR002100Transcription factor, MADS-box
SMARTSM004322.2E-29665IPR002100Transcription factor, MADS-box
CDDcd002654.79E-33775No hitNo description
SuperFamilySSF554551.03E-25789IPR002100Transcription factor, MADS-box
PRINTSPR004045.0E-17828IPR002100Transcription factor, MADS-box
PfamPF003194.7E-221562IPR002100Transcription factor, MADS-box
PRINTSPR004045.0E-172843IPR002100Transcription factor, MADS-box
PRINTSPR004045.0E-174364IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 478 aa     Download sequence    Send to blast
MPRICRGRQK LQMVKMENET NLQVTFSKRR AGLFKKASEL STLCGTELGL IVFSPGKKAF  60
CFGHPSIEEV LDKYEGRTSR QPLNHDMQQI AEACSHATTN ELNAELTQVM ERIEGERKRG  120
EELTQLLKAS QAECGLEGPV EELDLDRMEI LRASLMQLRS KVADQAKQKL AAAKTANPPH  180
NPNVYAGSSS SSAAAQSANP AHNNFFVGSS SSSAAAQSAN PSHNNFFVGS SSSSVAAQSA  240
NPAHNNFFVG SSSSSAAAGP SGLQGLANPE INNVGFNFNG NDFVMQAPDQ PNNFGFNFNG  300
AEPVLQAPDQ PNTLGFNFNG AEPVMQSPPD QPNTLGFNFN GAEPVMQSPP DQPNYLGFNF  360
NGAEPVMQAA PDQPNYLGFN FNGPYQHNLG FNFNGPDQPN NLGFNFNGAE PVMQAPLDQP  420
NNLGFNFNGP DQPNNLGFNF NGAESVMQAP PDQPNNVEFN GDPMFLSDWN PNLGGDFL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1egw_A3e-14774168MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POLYPEPTIDE A
1egw_B3e-14774168MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POLYPEPTIDE A
1egw_C3e-14774168MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POLYPEPTIDE A
1egw_D3e-14774168MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POLYPEPTIDE A
3kov_A4e-14774168Myocyte-specific enhancer factor 2A
3kov_B4e-14774168Myocyte-specific enhancer factor 2A
3kov_I4e-14774168Myocyte-specific enhancer factor 2A
3kov_J4e-14774168Myocyte-specific enhancer factor 2A
3mu6_A3e-14774168Myocyte-specific enhancer factor 2A
3mu6_B3e-14774168Myocyte-specific enhancer factor 2A
3mu6_C3e-14774168Myocyte-specific enhancer factor 2A
3mu6_D3e-14774168Myocyte-specific enhancer factor 2A
3p57_A4e-14774168Myocyte-specific enhancer factor 2A
3p57_B4e-14774168Myocyte-specific enhancer factor 2A
3p57_C4e-14774168Myocyte-specific enhancer factor 2A
3p57_D4e-14774168Myocyte-specific enhancer factor 2A
3p57_I4e-14774168Myocyte-specific enhancer factor 2A
3p57_J4e-14774168Myocyte-specific enhancer factor 2A
6bz1_A5e-14774269MEF2 CHIMERA
6bz1_B5e-14774269MEF2 CHIMERA
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapXP_008236215.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008236215.10.0PREDICTED: MADS-box transcription factor 29-like
TrEMBLA0A251N0P30.0A0A251N0P3_PRUPE; Uncharacterized protein
STRINGXP_008236215.10.0(Prunus mume)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF3986822
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G60440.13e-40AGAMOUS-like 62