PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_008234872.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Amygdaleae; Prunus
Family EIL
Protein Properties Length: 360aa    MW: 41139.9 Da    PI: 6.2528
Description EIL family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_008234872.1genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1EIN33942e-120923462262
                     XXXXXXXXXXXXXXXXXXXXXX..XXXXX.XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX CS
            EIN3   2 elkkrmwkdqmllkrlkerkkqlledkeaatgakksnksneqarrkkmsraQDgiLkYMlkemevcnaqGfvYgiipekgkpvegasdsLraWWk 96 
                     elkkrmwkd m+l++ ke +k  +ed+e+  +++++   +e++rrkkm+raQD+iLkYM+k+mevc+ +GfvYgi+pekgkpv+g+sdsLr+WWk
  XP_008234872.1  92 ELKKRMWKDHMRLRKFKEDRKI-IEDEEE-EEEAETLAKQEASRRKKMARAQDSILKYMVKIMEVCKGKGFVYGIVPEKGKPVTGSSDSLREWWK 184
                     9*************99999986.788887.555567899******************************************************** PP

                     XXXXXXXXXXXXXXXXXXXXXXXXXXXXX....XX----STTS-HHHHHHHHHHHSSSSSS-TTS--TTT--HHHH---S--HHHHHHT--TT-- CS
            EIN3  97 ekvefdrngpaaiskyqaknlilsgesslqtersseshslselqDTtlgSLLsalmqhcdppqrrfplekgvepPWWPtGkelwwgelglskdqg 191
                     +kv f+rn+p+ai++y    li+++++ +     s+ h l+elqDTtlgSLLsalmqhc p qrrfplekg++pPWWPtG+elwwg +g+s d+g
  XP_008234872.1 185 DKVIFNRNAPTAIAEY-FPALIFDQGELD---HGSYAHLLHELQDTTLGSLLSALMQHCVPAQRRFPLEKGLAPPWWPTGEELWWGDQGVSIDHG 275
                     ****************.558999977766...89************************************************************* PP

                     .-----GGG--HHHHHHHHHHHHHHTGGGHHHHHHTTTTSSSSTTT--SHHHHHHHHHHTTTTT-S--XXX CS
            EIN3 192 tppykkphdlkkawkvsvLtavikhmsptieeirelerqskylqdkmsakesfallsvlnqeekecatvsa 262
                     +ppy+kphdlkkawkvsvL+avikhm+p+++++r+l+rqs++lqdkm+ake++++++v+nqee +++   +
  XP_008234872.1 276 APPYRKPHDLKKAWKVSVLAAVIKHMAPNSDRMRRLVRQSRCLQDKMTAKETAIWSKVVNQEEVLLQLTET 346
                     **************************************************************987754443 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF048732.6E-11892338No hitNo description
Gene3DG3DSA:1.10.3180.101.5E-66214342IPR023278Ethylene insensitive 3-like protein, DNA-binding domain
SuperFamilySSF1167681.11E-58217341IPR023278Ethylene insensitive 3-like protein, DNA-binding domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 360 aa     Download sequence    Send to blast
MTHITQISVC EMESTSHELG GRTKLSVFEN EDGDTTSLRS HESKPALSTL YKTALKPEDL  60
LSVVEFHGKV DPLGLGVLAE DEEEVEDISY GELKKRMWKD HMRLRKFKED RKIIEDEEEE  120
EEAETLAKQE ASRRKKMARA QDSILKYMVK IMEVCKGKGF VYGIVPEKGK PVTGSSDSLR  180
EWWKDKVIFN RNAPTAIAEY FPALIFDQGE LDHGSYAHLL HELQDTTLGS LLSALMQHCV  240
PAQRRFPLEK GLAPPWWPTG EELWWGDQGV SIDHGAPPYR KPHDLKKAWK VSVLAAVIKH  300
MAPNSDRMRR LVRQSRCLQD KMTAKETAIW SKVVNQEEVL LQLTETCLKI SDSNEKEDQK
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4zds_A2e-592153401126Protein ETHYLENE INSENSITIVE 3
4zds_B2e-592153401126Protein ETHYLENE INSENSITIVE 3
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtPutative transcription factor that may be involved in the ethylene response pathway. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapXP_008234872.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008234872.10.0PREDICTED: ETHYLENE INSENSITIVE 3-like 5 protein
SwissprotQ9FJQ51e-120EIL5_ARATH; ETHYLENE INSENSITIVE 3-like 5 protein
TrEMBLA0A251NTY70.0A0A251NTY7_PRUPE; Uncharacterized protein
STRINGXP_008234872.10.0(Prunus mume)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF32234200
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G10120.11e-121EIL family protein
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]