PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_008234833.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Amygdaleae; Prunus
Family MYB_related
Protein Properties Length: 320aa    MW: 34878.4 Da    PI: 9.0509
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_008234833.1genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding377.8e-1260104147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      r +W++ E++++++a +++  + Wk+I + +g  +t  q++s+ qky
   XP_008234833.1  60 RESWSEPEHDKFLEALQLFDRD-WKKIEAFIG-SKTVIQIRSHAQKY 104
                      789*****************77.*********.*************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466892.09E-1554110IPR009057Homeodomain-like
PROSITE profilePS5129413.31555109IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.8E-558110IPR009057Homeodomain-like
TIGRFAMsTIGR015578.2E-1858107IPR006447Myb domain, plants
SMARTSM007172.0E-959107IPR001005SANT/Myb domain
PfamPF002491.4E-960104IPR001005SANT/Myb domain
CDDcd001672.78E-762105No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009651Biological Processresponse to salt stress
GO:0009723Biological Processresponse to ethylene
GO:0009737Biological Processresponse to abscisic acid
GO:0009739Biological Processresponse to gibberellin
GO:0009751Biological Processresponse to salicylic acid
GO:0009753Biological Processresponse to jasmonic acid
GO:0046686Biological Processresponse to cadmium ion
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 320 aa     Download sequence    Send to blast
MVSKNPNPPE GLYLDPSGMA LPGLGPFASV TTSATTTSTT SSLEDLSKKI RKPYTITKSR  60
ESWSEPEHDK FLEALQLFDR DWKKIEAFIG SKTVIQIRSH AQKYFLKVQK NGTSEHLPPP  120
RPKRKAAHPY PQKASKNALA LPQVSGSCQS SSALHESGFI QRPDSASMLM SPVPGTVVPS  180
WTDGSMQTAN LSHESKGPTG PNNSCSSTES TPKAQPVGGT TDLVIRSHAL RVLPDFSQVY  240
SFIGSVFDPD VTGHLQKLKK MDPIDVDTVL LLMRNLSINL SSPDFEDHRK LLSSYKIDAD  300
NATHGDAAKS LCDDQHKKVA
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor. {ECO:0000250}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00625PBMTransfer from PK02532.1Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapXP_008234833.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankDQ0744760.0DQ074476.1 Malus x domestica MYBR5 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008234833.10.0PREDICTED: protein REVEILLE 6
SwissprotQ8H0W31e-126RVE6_ARATH; Protein REVEILLE 6
TrEMBLM5XLG60.0M5XLG6_PRUPE; Uncharacterized protein
STRINGXP_008234833.10.0(Prunus mume)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF11193396
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G52660.11e-111MYB_related family protein
Publications ? help Back to Top
  1. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  2. Gray JA,Shalit-Kaneh A,Chu DN,Hsu PY,Harmer SL
    The REVEILLE Clock Genes Inhibit Growth of Juvenile and Adult Plants by Control of Cell Size.
    Plant Physiol., 2017. 173(4): p. 2308-2322
    [PMID:28254761]