PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_008234659.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Amygdaleae; Prunus
Family GRF
Protein Properties Length: 547aa    MW: 59564.4 Da    PI: 7.7748
Description GRF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_008234659.1genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRC77.31.5e-24158201144
             WRC   1 daepgrCrRtDGKkWRCsrrvlegkklCErHlhrgrsrsrkske 44 
                     d+epgrC+RtDGKkWRCsr+v +++k+CErH+hrgr rsrk++e
  XP_008234659.1 158 DPEPGRCKRTDGKKWRCSRDVAPDQKYCERHMHRGRPRSRKHVE 201
                     79****************************************98 PP

2QLQ57.15.3e-2098133237
             QLQ   2 aFTaaQlqlLksQilAyKyLaanqPvPpeLlqaiqk 37 
                     +FT++Q+ +L++Q+++yKy++a++PvP +Ll++i++
  XP_008234659.1  98 PFTNTQWKELERQAMIYKYMVASLPVPRDLLFPITR 133
                     8********************************975 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM009514.1E-1197133IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166621.42598133IPR014978Glutamine-Leucine-Glutamine, QLQ
PfamPF088801.0E-1398131IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166725.586158202IPR014977WRC domain
PfamPF088791.7E-20159201IPR014977WRC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0010114Biological Processresponse to red light
GO:0010218Biological Processresponse to far red light
GO:0080167Biological Processresponse to karrikin
GO:0005634Cellular Componentnucleus
GO:0005524Molecular FunctionATP binding
Sequence ? help Back to Top
Protein Sequence    Length: 547 aa     Download sequence    Send to blast
MMMVHHDNHR RPFSSSERGE ADGPTCNRPP VTDNYPNNNS VYDVVVAAAA GSSSSGGQVL  60
RGLQPFDISN RTTNTPISAH HTAFRSPAGG MTTSLGFPFT NTQWKELERQ AMIYKYMVAS  120
LPVPRDLLFP ITRAPSSPTI SQSPLSSGFN LRLSNSTDPE PGRCKRTDGK KWRCSRDVAP  180
DQKYCERHMH RGRPRSRKHV EVHANTTTKR VRHDINQAPP TMSPATVSIS NTTSINKNVC  240
QTQFIESTLQ PYHQSPMFLN RDTVKAATFD SMNSASSGRE PRSLDWLMMK GEPVQMATSD  300
PQWQHLMQSK TELNSKIPFF DANSCIFTRR SQEECFLNLN SYTNFNAGGE DQPDNECNMF  360
LNPDVVSLDN PLLEETPRCF IDAWSKTMID EDTMANSISN KDNSSAPSSG QLSPSSLTLS  420
MGGYNSINEE MGQTQMSLGN NGNGMKPGLS TWLSPASWVA SAPGGPLAEV LKPTTSAASN  480
PSSPITAATA NGELGSPLAT TVSSPSGVLQ KTFASLSDSS GNSSPTLASS RAKQPEIVSL  540
WLNQNKA
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150352e-33AP015035.1 Vigna angularis var. angularis DNA, chromosome 2, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008234659.10.0PREDICTED: growth-regulating factor 7 isoform X1
TrEMBLM5XKV00.0M5XKV0_PRUPE; Uncharacterized protein
STRINGVIT_16s0098g01080.t011e-147(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF73242842
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G53660.12e-34growth-regulating factor 7