PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_008234281.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Amygdaleae; Prunus
Family FAR1
Protein Properties Length: 893aa    MW: 101900 Da    PI: 5.231
Description FAR1 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_008234281.1genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1FAR181.11.9e-2577161388
            FAR1   3 YneYAkevGFsvrkskskkskrngeitkrtfvCskegkreeekkktekerrtraetrtgCkaklkvkkekdgkwevtkleleHnHe 88 
                     Yn+YA+ vGF+vrk+  +ksk +g++++r+f+Cskeg+r+++k++ ++ +++r+etrtgC a++ ++++ dgk++vt++e++HnH 
  XP_008234281.1  77 YNKYARLVGFNVRKDWVNKSKVHGQVVSRKFTCSKEGYRRKDKRD-VNVKKHRKETRTGCLAHMIITRQPDGKYRVTQFEEQHNHG 161
                     ******************************************999.999************************************5 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF031011.2E-2277161IPR004330FAR1 DNA binding domain
PfamPF105516.0E-26302396IPR018289MULE transposase domain
PROSITE profilePS5096610.126582618IPR007527Zinc finger, SWIM-type
SMARTSM005751.1E-5593620IPR006564Zinc finger, PMZ-type
PfamPF044344.7E-4595616IPR007527Zinc finger, SWIM-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 893 aa     Download sequence    Send to blast
MEREDDDFGS LHEDSMDVGL QATNRLDLNV EQDSRSPKVV YVNGTQSNPP SIGADSKDSV  60
LEVGTEFESD EHAYKSYNKY ARLVGFNVRK DWVNKSKVHG QVVSRKFTCS KEGYRRKDKR  120
DVNVKKHRKE TRTGCLAHMI ITRQPDGKYR VTQFEEQHNH GNVNSSIAQA LPEQHNHDNV  180
NLSIAQALPL QRECTVPEAA DADSVKELGS LSKSALDSMN RGYRVRESVD SFALDFENYL  240
QSERTRDMKE GAVGRLLHYF QRQHFENPSF FYAIQVDTDD KVSNILWADD NMVSDYDHFG  300
DVVCLDTVCR ADKNCLPFVQ FVGVNNHKQV VIFSAALLYD DTVQSYKWLF QTFLESMSGK  360
KPKAILTDQD AAIVEAINSV LPETDHRICT WQMCQNALKH LNHIVKDTES FANDFKSCIY  420
DQKDEDGFVY AWGNMLDNYG LQQNDWLRWM FREREKWAVV YGRNTFFVDR KGSHLVESLF  480
HDLRNYLYSD VDVLDFVKYF ERVVDEQRYK EIEANDEMNR CMPRLMGNVI LLKHASDVYT  540
PRAFEVFQRG YEKCLNIVVN QCSENGPLFE YKTNIFGKSR EHTVTFNSSD DAVICSCKKF  600
DSVGFLCSHA LKVLDHMNIK VVPSKYILKR WTKDARLGSA RENDVPSIRD NPKLVVASRY  660
KNMCGRIIML SAKASESEEA FQFAVGQLDE VMEGVEKILT LKPQDAQAFT SSSTANASDS  720
ERAVIFPDGN AIEDQDDNVV KEAKEKETAV FDKGQLTNVN GEFSSTKRIQ NVDASLQNTD  780
SCISSPSLYV SPEGTTANPI MQGLYNFEAN QVVQCMYQQD NLVMEEQTNP NMYQPLNFFS  840
NQHDSPGHSQ LLQEPLINGT YQEPVSSTPE LRQAMDLDVQ HAHSSSFLLL DRG
Cis-element ? help Back to Top
SourceLink
PlantRegMapXP_008234281.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008234281.10.0PREDICTED: protein FAR1-RELATED SEQUENCE 5-like
RefseqXP_008234282.10.0PREDICTED: protein FAR1-RELATED SEQUENCE 5-like
TrEMBLA0A251QN440.0A0A251QN44_PRUPE; Uncharacterized protein
STRINGXP_008234281.10.0(Prunus mume)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF4030530
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G38180.11e-102FAR1-related sequence 5