PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_008234278.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Amygdaleae; Prunus
Family HD-ZIP
Protein Properties Length: 808aa    MW: 88013 Da    PI: 6.4208
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_008234278.1genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox64.81.2e-20117172156
                     TT--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
        Homeobox   1 rrkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                     ++k +++t++q++eLe++F+++++p++++r eL+++l+L+++qVk+WFqNrR+++k
  XP_008234278.1 117 KKKYHRHTPSQIQELENFFKECPHPDEKQRLELSRRLSLETKQVKFWFQNRRTQMK 172
                     79999************************************************999 PP

2START175.23.9e-553275482206
                     HHHHHHHHHHHHHHHC-TT-EEEE....EXCCTTEEEEEEESSS....SCEEEEEEEECCSCHHHHHHHHHCCCGGCT-TT-S....EEEEEEEE CS
           START   2 laeeaaqelvkkalaeepgWvkss....esengdevlqkfeeskv...dsgealrasgvvdmvlallveellddkeqWdetla....kaetlevi 85 
                     la +a++elvk+a+a++p+W k s    e++n +e++     +     + +e  r++ +v+ ++  lve+l+d + +W e++     +a++++vi
  XP_008234278.1 327 LAMAAMDELVKMAQADSPLWIKTSdggtEILNHEEYRAFSCIGTKpsnFVTEGTRDTCMVIINSLALVETLMDAN-RWAEMFSclvaRASVIDVI 420
                     57799*******************99999999999987655544466679*************************.******************* PP

                     CTT......EEEEEEEEXXTTXX-SSX.EEEEEEEEEEE.TTS-EEEEEEEEE-TTS--.-TTSEE-EESSEEEEEEEECTCEEEEEEEE-EE-- CS
           START  86 ssg......galqlmvaelqalsplvp.RdfvfvRyirqlgagdwvivdvSvdseqkppesssvvRaellpSgiliepksnghskvtwvehvdlk 173
                     ssg      galq+m aelq+lsplvp R   f+R+++q+++g+w++vdvS+d +q+ +++  +  ++++pSg+++++++n+ skvtw+eh +++
  XP_008234278.1 421 SSGmggtrnGALQVMHAELQVLSPLVPvRPLKFLRFCKQHQEGVWAVVDVSIDINQEGSNTNAFLNCRRFPSGCIVQDMPNNCSKVTWIEHSEYD 515
                     *********************************************************************************************** PP

                     SSXXHHHHHHHHHHHHHHHHHHHHHHTXXXXXX CS
           START 174 grlphwllrslvksglaegaktwvatlqrqcek 206
                     ++++h l+ +l++sg+ +ga++w++tlqrqce+
  XP_008234278.1 516 ENTVHHLFWQLLRSGMGFGAQRWLSTLQRQCEC 548
                     *******************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.603.1E-21100172IPR009057Homeodomain-like
SuperFamilySSF466891.8E-20103174IPR009057Homeodomain-like
PROSITE profilePS5007117.702114174IPR001356Homeobox domain
SMARTSM003892.8E-18116178IPR001356Homeobox domain
PfamPF000463.1E-18117172IPR001356Homeobox domain
CDDcd000861.67E-19117174No hitNo description
PROSITE patternPS000270149172IPR017970Homeobox, conserved site
PROSITE profilePS5084842.956317551IPR002913START domain
SuperFamilySSF559617.83E-32318548No hitNo description
CDDcd088753.75E-113321547No hitNo description
SMARTSM002342.5E-37326548IPR002913START domain
PfamPF018527.3E-47327548IPR002913START domain
SuperFamilySSF559611.07E-16575802No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0008289Molecular Functionlipid binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 808 aa     Download sequence    Send to blast
MSFGGLISGG SGNSGGGGAR VVADIAPHAP YMPSGAIAQP HFLTSPVPNS MRSSSALSLS  60
IKNMDGHSEL GLIAENFDPG IIGRMRDDEY ESRSGSDNFE GASGDDQDAG DEQRPRKKKY  120
HRHTPSQIQE LENFFKECPH PDEKQRLELS RRLSLETKQV KFWFQNRRTQ MKTQLERHEN  180
IILRQENDKL RAENGVMKDA MANPVCNSCG GPAIPGQISF EEHQLRIENA RLKDELNRIC  240
TLANKFLGRP ISSLASPISL PNSTSGLELG VGRNGIGGLS AGGSGLPMGL NLGDGVSSSS  300
PMMPLIKSST GMLGNEVPYE RSMYIDLAMA AMDELVKMAQ ADSPLWIKTS DGGTEILNHE  360
EYRAFSCIGT KPSNFVTEGT RDTCMVIINS LALVETLMDA NRWAEMFSCL VARASVIDVI  420
SSGMGGTRNG ALQVMHAELQ VLSPLVPVRP LKFLRFCKQH QEGVWAVVDV SIDINQEGSN  480
TNAFLNCRRF PSGCIVQDMP NNCSKVTWIE HSEYDENTVH HLFWQLLRSG MGFGAQRWLS  540
TLQRQCECLA FLISSTNSIE DHTGLGTNGK KSMLKLAQRM IDNFCAGVSA SSVRNWDKLC  600
VNNVSEDLRV MARKSVDDPG EPSGIVLSGS TSVWLPVSRH RLFDFLRDEQ LRDQWDVLSK  660
THKMQLMLRI AKSQGGGNCV SLLRANVVDA NENTMLMLQE SWSDASGSLV VYAPVDPASM  720
SAVMRGGDSA YVALLPSGFA ILPGGPPGYG MVKTEGNGCD DGGCFLTVGF QILGSNYPAA  780
KLNVQSINTV NTLVSHTIEK IKSALQVP
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor involved in the regulation of the tissue-specific accumulation of anthocyanins and in cellular organization of the primary root. {ECO:0000269|PubMed:10402424}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapXP_008234278.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008234278.10.0PREDICTED: homeobox-leucine zipper protein HDG7
SwissprotQ0WV120.0ANL2_ARATH; Homeobox-leucine zipper protein ANTHOCYANINLESS 2
TrEMBLA0A251QN550.0A0A251QN55_PRUPE; Uncharacterized protein
STRINGXP_008234278.10.0(Prunus mume)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF119234106
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G00730.10.0HD-ZIP family protein
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]