PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_008233316.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Amygdaleae; Prunus
Family GATA
Protein Properties Length: 351aa    MW: 37549.1 Da    PI: 5.7235
Description GATA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_008233316.1genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GATA54.12.1e-17254287134
            GATA   1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkg 34 
                     C +C  tkTp+WR gp g+ktLCnaCG++y++ +
  XP_008233316.1 254 CLHCEITKTPQWRAGPMGPKTLCNACGVRYKSGR 287
                     99*****************************987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PIRSFPIRSF0169925.0E-743342IPR016679Transcription factor, GATA, plant
PROSITE profilePS5011411.451248284IPR000679Zinc finger, GATA-type
SMARTSM004011.8E-16248298IPR000679Zinc finger, GATA-type
SuperFamilySSF577167.13E-15252311No hitNo description
Gene3DG3DSA:3.30.50.101.5E-14252285IPR013088Zinc finger, NHR/GATA-type
CDDcd002024.69E-14253300No hitNo description
PfamPF003204.4E-15254287IPR000679Zinc finger, GATA-type
PROSITE patternPS003440254279IPR000679Zinc finger, GATA-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0007623Biological Processcircadian rhythm
GO:0009845Biological Processseed germination
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008270Molecular Functionzinc ion binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 351 aa     Download sequence    Send to blast
MIGPNFIDEI DCGSFFDTID DLLDFPNDDV ESGLGPASDC NAAFNNSLWP NQSGSLPAPN  60
DAVFSAGNSA SDLSAELSVP IEDIVQLEWL SNFVEDSFSG GSLTINKPDS FINKDTSHHQ  120
FQTSSPISVL DSSSSCSGDK NVPQSPGPIA APGKRGRARS KRLSPATFNP RSAIQLISPA  180
SSVTEAEGPQ AQPFLAPKVP SDSENFAESR PVIKIPKQAS GEQKKKKKLK VSLPLAPLEG  240
NQNSGPTQAA VRKCLHCEIT KTPQWRAGPM GPKTLCNACG VRYKSGRLFP EYRPAASPTF  300
VPSLHSNSHK KVLEMRTKGG ELVVFGETAT AMNETPELIP NTNSSISMDY M
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00130DAPTransfer from AT1G08010Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapXP_008233316.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008233316.10.0PREDICTED: GATA transcription factor 8
RefseqXP_008233317.10.0PREDICTED: GATA transcription factor 8
TrEMBLM5XD360.0M5XD36_PRUPE; GATA transcription factor
STRINGXP_008233316.10.0(Prunus mume)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF48873356
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G54810.23e-43GATA family protein