PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_008232985.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Amygdaleae; Prunus
Family MYB_related
Protein Properties Length: 349aa    MW: 38270.9 Da    PI: 8.3079
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_008232985.1genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding42.31.7e-1378122147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      r +WT++E++++++a +++  + Wk+I + +g  +t  q++s+ qky
   XP_008232985.1  78 RESWTEQEHDKFLEALQLFDRD-WKKIEAFVG-SKTVIQIRSHAQKY 122
                      789*****************77.*********.*************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466891.27E-1672128IPR009057Homeodomain-like
PROSITE profilePS5129415.40873127IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.3E-676128IPR009057Homeodomain-like
TIGRFAMsTIGR015571.6E-1876125IPR006447Myb domain, plants
SMARTSM007175.3E-1177125IPR001005SANT/Myb domain
PfamPF002493.0E-1178122IPR001005SANT/Myb domain
CDDcd001672.30E-880123No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009651Biological Processresponse to salt stress
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 349 aa     Download sequence    Send to blast
MVSVNPNPAQ GFYLFDPMNM GLPGLNSMPP PTATATTASA ATSTTACTAS STPTNATSLL  60
AEDQSKKIRK PYTITKSRES WTEQEHDKFL EALQLFDRDW KKIEAFVGSK TVIQIRSHAQ  120
KYFLKVQKKG TSEHVPPPRP KRKATHPYPQ KAPKSAAVVS QVAGQFQSSS ALLEHGYVYQ  180
PDSSFALGTP VTSATLSSWS YNSVPPVNVS QITKDDGRLA GPTVAHNSCY SSSNESNPTT  240
WQMSEKVDRA DPGQPHRVLP DFAQVYKFIG SVFDPNATSH LERLKELDPI NLETVLLLMR  300
NLSLNLTSPE FEDHRKLLSS YDADSEKAKS DSNCNFSCIG KSENAILSA
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapXP_008232985.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008232985.10.0PREDICTED: protein REVEILLE 3
SwissprotQ6R0H01e-113RVE3_ARATH; Protein REVEILLE 3
TrEMBLA0A314UHP00.0A0A314UHP0_PRUYE; Protein REVEILLE 3
STRINGXP_008232985.10.0(Prunus mume)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF11193396
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G01520.11e-101MYB_related family protein
Publications ? help Back to Top
  1. Manfield IW, et al.
    Arabidopsis Co-expression Tool (ACT): web server tools for microarray-based gene expression analysis.
    Nucleic Acids Res., 2006. 34(Web Server issue): p. W504-9
    [PMID:16845059]
  2. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  3. Gray JA,Shalit-Kaneh A,Chu DN,Hsu PY,Harmer SL
    The REVEILLE Clock Genes Inhibit Growth of Juvenile and Adult Plants by Control of Cell Size.
    Plant Physiol., 2017. 173(4): p. 2308-2322
    [PMID:28254761]
  4. Huang KC,Lin WC,Cheng WH
    Salt hypersensitive mutant 9, a nucleolar APUM23 protein, is essential for salt sensitivity in association with the ABA signaling pathway in Arabidopsis.
    BMC Plant Biol., 2018. 18(1): p. 40
    [PMID:29490615]