PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_008232741.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Amygdaleae; Prunus
Family HD-ZIP
Protein Properties Length: 829aa    MW: 90247.2 Da    PI: 6.3958
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_008232741.1genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox65.48e-21124179156
                     TT--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
        Homeobox   1 rrkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                     +++ +++t++q++eLe+lF+++++p++++r eL+++l L++rqVk+WFqNrR+++k
  XP_008232741.1 124 KKRYHRHTPQQIQELEALFKECPHPDEKQRLELSRRLCLETRQVKFWFQNRRTQMK 179
                     688999***********************************************999 PP

2START206.79.1e-653315551206
                     HHHHHHHHHHHHHHHHC-TT-EEEE....EXCCTTEEEEEEESSS......SCEEEEEEEECCSCHHHHHHHHHCCCGGCT-TT-S....EEEEE CS
           START   1 elaeeaaqelvkkalaeepgWvkss....esengdevlqkfeeskv.....dsgealrasgvvdmvlallveellddkeqWdetla....kaetl 82 
                     ela++a++elvk+a+ +ep+W +s     e +n +e++++f++  +     + +ea+r++g+v+ ++  lve+l++++ +W e+++    + +t+
  XP_008232741.1 331 ELALAAMDELVKLAQTDEPLWLRSLeggrEVLNHEEYMRSFTPCIGlkpngFVTEASRETGMVIINSLALVETLMESN-RWLEMFPclvaRTSTT 424
                     5899************************99***********9999899999***************************.**************** PP

                     EEECTT......EEEEEEEEXXTTXX-SSX.EEEEEEEEEEE.TTS-EEEEEEEEE-TTS--.-TTSEE-EESSEEEEEEEECTCEEEEEEEE-E CS
           START  83 evissg......galqlmvaelqalsplvp.RdfvfvRyirqlgagdwvivdvSvdseqkppesssvvRaellpSgiliepksnghskvtwvehv 170
                     +vissg      galqlm aelq+lsplvp R++ f+R+++q+ +g+w++vdvSvd  ++ +  + ++ +++lpSg+++++++ng+skvtwveh+
  XP_008232741.1 425 DVISSGmggtrnGALQLMHAELQVLSPLVPvREVNFLRFCKQHAEGVWAVVDVSVDTIRDTSGAPTFMNCRRLPSGCVVQDMPNGYSKVTWVEHA 519
                     ************************************************************999******************************** PP

                     E--SSXXHHHHHHHHHHHHHHHHHHHHHHTXXXXXX CS
           START 171 dlkgrlphwllrslvksglaegaktwvatlqrqcek 206
                     +++++++h+l+r++++sg+ +ga++wvatlqrqce+
  XP_008232741.1 520 EYDESQVHQLYRPMLSSGMGFGAQRWVATLQRQCEC 555
                     **********************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466894.23E-21104181IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.602.7E-22108181IPR009057Homeodomain-like
PROSITE profilePS5007117.524121181IPR001356Homeobox domain
SMARTSM003895.7E-17122185IPR001356Homeobox domain
PfamPF000462.2E-18124179IPR001356Homeobox domain
CDDcd000862.25E-18124181No hitNo description
PROSITE patternPS000270156179IPR017970Homeobox, conserved site
PROSITE profilePS5084843.985322558IPR002913START domain
SuperFamilySSF559618.79E-33323555No hitNo description
CDDcd088752.58E-125326554No hitNo description
PfamPF018528.8E-57331555IPR002913START domain
SMARTSM002348.6E-47331555IPR002913START domain
SuperFamilySSF559611.73E-23576754No hitNo description
SuperFamilySSF559611.73E-23783816No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009827Biological Processplant-type cell wall modification
GO:0042335Biological Processcuticle development
GO:0043481Biological Processanthocyanin accumulation in tissues in response to UV light
GO:0048765Biological Processroot hair cell differentiation
GO:0008289Molecular Functionlipid binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 829 aa     Download sequence    Send to blast
MSFGGFLDNS TGSGGGARIV ADISYNNTSS STHSNNMPSS ALAQPRLVTQ SLTKSMFNSP  60
GLSLALQTNA DGQGDVTRMA ENFETHVGRR SREEEHESRS GSDNMDGGSG DDQDAADNTN  120
PRKKKRYHRH TPQQIQELEA LFKECPHPDE KQRLELSRRL CLETRQVKFW FQNRRTQMKT  180
QLERHENSLL RQENDKLRAE NMSIRDAMRN PICSNCGGPA IIGEISLEEQ HLRIENARLK  240
DELDRVCALA GKFLGRPISS LATSMGPPLP SSTLELGVGS NGFGGLSSVA TSMPVGPDFG  300
GGIGSAMSVV PHSRPSATGL DRSMERSMFL ELALAAMDEL VKLAQTDEPL WLRSLEGGRE  360
VLNHEEYMRS FTPCIGLKPN GFVTEASRET GMVIINSLAL VETLMESNRW LEMFPCLVAR  420
TSTTDVISSG MGGTRNGALQ LMHAELQVLS PLVPVREVNF LRFCKQHAEG VWAVVDVSVD  480
TIRDTSGAPT FMNCRRLPSG CVVQDMPNGY SKVTWVEHAE YDESQVHQLY RPMLSSGMGF  540
GAQRWVATLQ RQCECLAILM SSSVPTRDHT AITSSGRRSM LKLAQRMTDN FCAGVCASTV  600
HKWNKLNARN VDEDVRVMTR ESLDDPGEPP GIVLSAATSV WLPVSPQRLF DFLRDERLRS  660
EWDILSNGGP MQEMAHIAKG QDPGNCVSLL RARAMNANQS SMLILQETCI DAAGGLVVYA  720
PVDIPAMHVV MNGGDSAYVA LLPSGFAIVP DGPGSRGPMT VKGGGHGSNN GGGGEDATHR  780
VSGSLLTMTF QILVNSLPSA KLTVESVETV NNLISCTVQK IKAALHCES
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor involved in the regulation of the tissue-specific accumulation of anthocyanins and in cellular organization of the primary root. {ECO:0000269|PubMed:10402424}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00421DAPTransfer from AT4G00730Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapXP_008232741.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008232741.10.0PREDICTED: homeobox-leucine zipper protein ANTHOCYANINLESS 2 isoform X1
SwissprotQ0WV120.0ANL2_ARATH; Homeobox-leucine zipper protein ANTHOCYANINLESS 2
TrEMBLM5XQZ70.0M5XQZ7_PRUPE; Uncharacterized protein
STRINGXP_008232741.10.0(Prunus mume)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF119234106
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G00730.10.0HD-ZIP family protein
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]