PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_008232699.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Amygdaleae; Prunus
Family GRF
Protein Properties Length: 445aa    MW: 47984.8 Da    PI: 9.8289
Description GRF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_008232699.1genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRC70.91.5e-22113158146
             WRC   1 daepgrCrRtDGKkWRCsrrvlegkklCErHlhrgrsrsrkskees 46 
                     d epgrCrRtDGKkWRC ++v++++k+C+ H+hrgr+rsrk++e+s
  XP_008232699.1 113 DHEPGRCRRTDGKKWRCNKNVVPDQKYCQQHMHRGRQRSRKPVENS 158
                     679***************************************9985 PP

2WRC63.92.3e-20325366243
             WRC   2 aepgrCrRtDGKkWRCsrrvlegkklCErHlhrgrsrsrksk 43 
                      epgrCrRtDGKkWRC+r+vl+ +k+C  H+hrg +r+ k +
  XP_008232699.1 325 LEPGRCRRTDGKKWRCRRDVLPHQKYCGQHIHRGAKRQMKDF 366
                     59************************************9976 PP

3QLQ56.86.6e-204680337
             QLQ  3 FTaaQlqlLksQilAyKyLaanqPvPpeLlqaiqk 37
                    +Ta+Ql++L++Q+l+yK++aan+PvP +L+++i+k
  XP_008232699.1 46 LTASQLHELEQQALIYKHFAANLPVPFHLVLPIWK 80
                    7********************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM009514.3E-114480IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166622.14580IPR014978Glutamine-Leucine-Glutamine, QLQ
PfamPF088803.8E-134679IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166723.545113157IPR014977WRC domain
PfamPF088791.5E-19115156IPR014977WRC domain
PROSITE profilePS5166721.09324368IPR014977WRC domain
PfamPF088793.9E-17326365IPR014977WRC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0005524Molecular FunctionATP binding
Sequence ? help Back to Top
Protein Sequence    Length: 445 aa     Download sequence    Send to blast
MTMEEEGGGK VKLGLGIGVD CYGDDHNGTE EVVVGKKKKK YGGGGLTASQ LHELEQQALI  60
YKHFAANLPV PFHLVLPIWK SVAASFGSSN AAAINRQYPS FVGFSATGFD YRDHEPGRCR  120
RTDGKKWRCN KNVVPDQKYC QQHMHRGRQR SRKPVENSEV ASPSSTKTPK NSEGELGNSK  180
TNLQISTPKG LQLMAQSYNY VSVSQGTTMA SSGYHECKKN VRPVTTTSIA NIPANRSART  240
NPAAVATTTI AGPTTATNSS TNENSLNIGV KYNSSNHAGG NCMIRGSSMN VVNVSPGLGF  300
SPKSVLQALL GCNGLYFDNG SGVELEPGRC RRTDGKKWRC RRDVLPHQKY CGQHIHRGAK  360
RQMKDFQPVA VPYSSAAAMN TARLSQTTAI CRKTNCAIPN TNLSISIPAN PPPGRNDERS  420
NSSSDSDTTL TDTSLTACDS SYVSS
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008232699.10.0PREDICTED: growth-regulating factor 9 isoform X3
TrEMBLM5X5V30.0M5X5V3_PRUPE; Uncharacterized protein
STRINGVIT_15s0048g01740.t013e-95(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF92282022
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G37740.13e-30growth-regulating factor 2