PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_008232558.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Amygdaleae; Prunus
Family GATA
Protein Properties Length: 251aa    MW: 27904.7 Da    PI: 5.5748
Description GATA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_008232558.1genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GATA56.83.1e-18158192135
            GATA   1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkgl 35 
                     C++C + kTp+WR gp g+ktLCnaCG+++++ +l
  XP_008232558.1 158 CAHCASEKTPQWRAGPMGPKTLCNACGVRFKSGRL 192
                     *******************************9885 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PIRSFPIRSF0169925.6E-716246IPR016679Transcription factor, GATA, plant
SMARTSM004014.0E-17152202IPR000679Zinc finger, GATA-type
PROSITE profilePS5011411.451152188IPR000679Zinc finger, GATA-type
SuperFamilySSF577161.09E-14154215No hitNo description
Gene3DG3DSA:3.30.50.103.4E-14156190IPR013088Zinc finger, NHR/GATA-type
CDDcd002021.50E-13157204No hitNo description
PROSITE patternPS003440158183IPR000679Zinc finger, GATA-type
PfamPF003204.2E-16158192IPR000679Zinc finger, GATA-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009416Biological Processresponse to light stimulus
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008270Molecular Functionzinc ion binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 251 aa     Download sequence    Send to blast
MEDVYGGGAS ASLAQQQDYF PIDDLLDLSN DDLFSSSTSS TDSIDLHPPP PPPHPHVSST  60
PFNPTAATDF TNDLCVPSDD VAELEWLSRF VDDSFTDFPT TNVFGSASFP NDTSSLFPSR  120
VRTNRSKWGG PPEPSDSRAK PKREPSEASP SPSKPRRCAH CASEKTPQWR AGPMGPKTLC  180
NACGVRFKSG RLVPEYRPAA SPTFVLTQHS NSHRKVLELR RQKEASEQQQ PEEQHQQKQQ  240
FYLHLDEYQV C
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional activator that specifically binds 5'-GATA-3' or 5'-GAT-3' motifs within gene promoters. May be involved in the regulation of some light-responsive genes. {ECO:0000269|PubMed:12139008}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00415DAPTransfer from AT3G60530Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapXP_008232558.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008232558.10.0PREDICTED: GATA transcription factor 4
SwissprotO497436e-63GATA4_ARATH; GATA transcription factor 4
TrEMBLA0A314U8121e-143A0A314U812_PRUYE; GATA transcription factor
STRINGXP_008232558.10.0(Prunus mume)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF135501925
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G60530.12e-57GATA transcription factor 4
Publications ? help Back to Top
  1. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]